(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0367

BA000037.VV0367      Location/Qualifiers
FT   CDS_pept        complement(377709..377918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93131"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93131"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ6"
FT                   /protein_id="BAC93131.1"
FT                   /translation="MHTGIYSPDATFENALTALDNIEQSNINTGNEAVIPSHTTCCTMG
FT                   PRVREDDEIGEGKKKQTETAASAI"
     gtgcacacgg gaatctattc gccggatgcc acttttgaaa acgcactcac cgcattagac        60
     aacatagaac aatccaacat caacactggc aatgaagcgg taataccaag ccacaccact       120
     tgctgtacga tgggtccccg cgtgcgcgag gatgacgaga taggagaagg aaagaaaaag       180
     cagacagaaa cagcagcgtc agcgatataa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page