(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0374

BA000037.VV0374      Location/Qualifiers
FT   CDS_pept        384040..384351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0374"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93138"
FT                   /db_xref="GOA:Q7MPI9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI9"
FT                   /protein_id="BAC93138.1"
FT                   /translation="MQNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKKARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
     atgcagaacc aacgtatccg tatccgcctt aaagctttcg attacaaact aatcgacgct        60
     tcaacagcgg aaatcgttga aacagctaag cgcactggcg cacaggttcg tggtccaatc       120
     ccactaccta ctcgtaaaga gcgtttcacc gttcttatct ctccacacgt taacaagaaa       180
     gctcgtgacc agtacgaaat tcgtactcac aagcgtctaa tcgacatcgt tgagccaaca       240
     gacaaaactg ttgacgctct gatgcgtcta gaccttgctg caggcgttga cgttcaaatt       300
     agcctaggtt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page