(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0375

BA000037.VV0375      Location/Qualifiers
FT   CDS_pept        384366..384995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0375"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93139"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93139"
FT                   /db_xref="GOA:Q7MPI8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI8"
FT                   /protein_id="BAC93139.1"
FT                   /translation="MIGLIGRKVGMTRVFTEEGVSIPVTVVEVEANRIAQVKTLETDGY
FT                   AAIQVTAGTKKANRVNKAEAGHFAKAGVEAGRGLWEFRLENGEEFAVGSELTVELFNEV
FT                   KKVDVTGTSKGKGFQGTVKRWNFRTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKKMAG
FT                   HMGAERVTTQNLEIVRVDAERNLLLIKGAVPGATGGNVIVKPAVKA"
     atgattggtc taatcggtcg taaagtgggc atgacccgcg tatttactga agaaggcgtt        60
     tctatccctg taactgttgt tgaggttgaa gcgaaccgta ttgctcaagt gaaaactctt       120
     gagactgacg gctatgcagc aatccaagtt acagctggta caaagaaagc taaccgtgta       180
     aacaaagctg aagcaggtca ctttgctaaa gctggcgttg aagctggtcg tggtctttgg       240
     gaattccgtt tagaaaacgg cgaagagttt gcagttggtt cagaactaac tgttgaacta       300
     ttcaacgaag ttaaaaaagt agacgttact ggtacatcta agggtaaagg tttccaaggc       360
     actgttaagc gctggaactt ccgcactcaa gatatgactc acggtaactc attgtctcac       420
     cgtgctcctg gttctatcgg tcaatgtcag actccaggtc gcgtatttaa aggcaagaaa       480
     atggcaggtc acatgggtgc tgagcgtgta acgactcaaa acctagagat cgtacgtgtt       540
     gacgctgagc gcaatctgct tcttattaaa ggtgcagtcc ctggcgcaac tggcggtaac       600
     gtgatcgtta aaccagctgt taaagcataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page