(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0377

BA000037.VV0377      Location/Qualifiers
FT   CDS_pept        385611..385913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0377"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93141"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93141"
FT                   /db_xref="GOA:Q7MPI6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI6"
FT                   /protein_id="BAC93141.1"
FT                   /translation="MITQERLLKVLRAPHISEKATMAAEKANTIVFKVAKDATKKEIKA
FT                   AVEQLFEVEVKSVNTLITKGKTKRQGLRQGRRSDVKKAYVTLKEGQDLDFVGGAE"
     atgatcactc aagagcgtct actaaaagtt ctacgtgcac cgcacatctc tgaaaaagca        60
     actatggcag ctgagaaagc gaacactatc gttttcaaag tagctaaaga tgcaactaag       120
     aaagagatca aagcagctgt agaacagcta tttgaagttg aagttaagtc tgtaaatact       180
     cttatcacta agggtaagac caagcgtcaa ggtctacgcc aaggccgtcg ttcagacgtg       240
     aagaaagcgt acgttacttt gaaagaaggt caagatcttg actttgttgg cggcgcggaa       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page