(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0382

BA000037.VV0382      Location/Qualifiers
FT   CDS_pept        388129..388539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0382"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93146"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93146"
FT                   /db_xref="GOA:Q7MPI1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI1"
FT                   /protein_id="BAC93146.1"
FT                   /translation="MLQPKRTKFRKVHTGRNRGLAKGTEVSFGSFGLKAVGRGRLTARQ
FT                   IEAARRAMTRHIKRQGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVMYE
FT                   VDGVPEELAREAFRLAARKLPFKTTFVTKQVM"
     atgctacaac ctaaacgtac taagttccgt aaggttcata ctggtcgtaa ccgcggtcta        60
     gctaaaggta ctgaagttag ctttggttct tttggtctta aagctgttgg ccgtggtcgt       120
     ttgactgctc gtcaaatcga agctgcacgt cgtgctatga cgcgtcacat caagcgtcaa       180
     ggtaagatct ggatccgtgt gttcccagac aagccgatca ctgaaaaacc acttgaagtt       240
     cgtcaaggta agggtaaagg taacgttgag tactgggtag cccaaatcca acctggtaag       300
     gttatgtacg aagttgatgg tgtacctgaa gaattggcgc gtgaagcgtt ccgcctagcg       360
     gctcgcaaac tgccattcaa gactacattt gtaactaagc aggtgatgtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page