(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0385

BA000037.VV0385      Location/Qualifiers
FT   CDS_pept        389147..389518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0385"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93149"
FT                   /db_xref="GOA:Q7MPH8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH8"
FT                   /protein_id="BAC93149.1"
FT                   /translation="MIQMQSMLDAADNSGARSVMCIKVLGGSHRRYAHIGDVIKVTVKE
FT                   AIPRGKVKKGDVLKAVVVRTRKGVRRPDGSVIRFDRNACVLLNNNTEQPIGTRIFGPVT
FT                   RELRGDKFMKIVSLAPEVL"
     atgatccaaa tgcaaagtat gctggacgca gctgataact caggcgctcg cagcgtaatg        60
     tgtattaagg ttctgggtgg ctctcaccgc cgttatgcac atatcggtga cgttatcaaa       120
     gttactgtta aggaagcaat tcctcgcggt aaagttaaaa aaggtgacgt tctgaaggcg       180
     gtggtagttc gcacccgtaa aggcgtacgt cgtccagacg gttctgtcat tcgcttcgac       240
     cgaaatgctt gtgtgttgct aaacaacaac actgagcaac caatcggtac acgtatcttt       300
     ggtcctgtga ctcgcgaact tcgtggcgat aagttcatga agatcgtttc actggctcca       360
     gaagttctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page