(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0387

BA000037.VV0387      Location/Qualifiers
FT   CDS_pept        389876..390415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0387"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93151"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93151"
FT                   /db_xref="GOA:Q7MPH6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH6"
FT                   /protein_id="BAC93151.1"
FT                   /translation="MAKLHDYYKSSVVAELTKQFGYTSVMQVPRIEKITLNMGVGDAIN
FT                   DKKLLENAAADMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFMERLI
FT                   SIALPRVRDFRGVNAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSAGTD
FT                   EEGRALLAAFNFPFRK"
     atggcgaaac tgcatgatta ctacaagtcg tctgtagtcg ctgaactgac caaacagttc        60
     ggttacacaa gcgtcatgca agtccctaga atcgaaaaga tcacccttaa catgggtgtg       120
     ggcgatgcta tcaacgataa gaaactgcta gaaaacgcag ctgctgatat ggcaacgatc       180
     tctggtcaaa agccacttat cactaaagcg cgtaaatctg ttgcaggttt caaaatccgc       240
     gaaggctacc ctatcggttg taaagtaacc ttgcgtggcg aacgtatgtg ggattttatg       300
     gagcgtctaa tctctatcgc tcttccacgt gtacgtgact tccgtggtgt taacgctaag       360
     tcttttgacg gtcgcggtaa ctacagcatg ggcgttcgcg agcaaatcat cttcccggaa       420
     atcgactttg ataaagttga tcgtgtacgc ggcctagaca tcactattac gacgtctgct       480
     ggtactgatg aggaaggccg tgctctgctg gctgccttta acttcccatt ccgtaagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page