(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0390

BA000037.VV0390      Location/Qualifiers
FT   CDS_pept        391174..391707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0390"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93154"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93154"
FT                   /db_xref="GOA:Q7MPH3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH3"
FT                   /protein_id="BAC93154.1"
FT                   /translation="MSRVAKAPVAIPAGVEVKLNGQEITVKGAKGELSRVINNAVVIAQ
FT                   EENKLTFGPREGVANAWAQAGTARALVNNMVVGVTEGFTRKLILKGVGYRAAIKGNAVG
FT                   LTLGFSHPVEHELPAGIKAECPSQTEIVLTGCDKQLIGQVAADIRAYRAPEPYKGKGIR
FT                   YADENVRSKEAKKK"
     atgtctcgtg ttgctaaagc acctgtcgct attccagctg gcgtagaggt gaaactgaac        60
     ggccaagaaa tcactgtaaa aggtgctaaa ggtgaactat ctcgcgttat caacaacgca       120
     gtagttatcg ctcaggaaga aaacaagcta actttcggtc ctcgcgaagg tgttgctaac       180
     gcatgggcac aagcaggtac tgctcgcgct ctagttaaca acatggttgt aggtgttact       240
     gaaggcttta cccgtaagct aatccttaag ggtgtaggtt accgtgctgc tatcaaaggc       300
     aatgcggttg gtctaactct tggcttctct cacccagttg agcatgaatt gccagcgggt       360
     atcaaagctg agtgtcctag ccaaactgaa atcgttctaa ctggttgtga taagcagttg       420
     atcggtcaag ttgcagcaga cattcgtgct taccgcgcgc ctgagcctta caaaggtaaa       480
     ggtattcgtt acgcagatga aaatgtgcgt agtaaagaag ctaagaagaa gtaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page