(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0391

BA000037.VV0391      Location/Qualifiers
FT   CDS_pept        391717..392070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0391"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93155"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93155"
FT                   /db_xref="GOA:Q7MPH2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH2"
FT                   /protein_id="BAC93155.1"
FT                   /translation="MDKKASRIRRATRARRKIAELGATRLVVHRTPRHVYAQVIAANGS
FT                   EVIAAASTVEKAIREQVKYTGNIEAAKAVGKAVAERALEKGVSTVAFDRSGFQYHGRVA
FT                   ALADSAREAGLKF"
     atggataaga aagcatctcg catccgtcgt gctacacgtg cacgtcgtaa gattgcagaa        60
     cttggtgcaa ctcgcctggt agtacaccgt actcctcgcc acgtttacgc tcaagttatc       120
     gcagcaaacg gctctgaggt tatcgcagca gcttctactg tagaaaaagc gatccgtgag       180
     caagtgaaat acactggtaa catcgaagca gctaaagcag ttggtaaagc tgtagcagag       240
     cgcgctcttg aaaaaggcgt atctactgtt gcattcgatc gttctggttt ccaataccac       300
     ggtcgagtag cggcgctagc agattctgct cgcgaagctg gtctgaaatt ctaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page