(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0392

BA000037.VV0392      Location/Qualifiers
FT   CDS_pept        392085..392588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0392"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93156"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93156"
FT                   /db_xref="GOA:Q7MPH1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH1"
FT                   /protein_id="BAC93156.1"
FT                   /translation="MAKEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNG
FT                   RVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGT
FT                   GVIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVE
FT                   AISE"
     atggctaaag aacaacaagt tcaagcgaat gatttgcaag aaaagctaat cgcagttaac        60
     cgtgtttcta aaacggttaa aggtggtcga atcatgagct ttactgcact aacagtagtt       120
     ggtgacggta acggtcgtgt aggtttcggt tacggcaaag ctcgtgaagt acctgcagcg       180
     atccaaaaag caatggaaaa agcgcgtcgt aacatggtta ctatcgcact taacgaaggc       240
     acacttcacc acccagtgaa aggtcgccac tcgggctcta aagtttacat gcagcctgct       300
     gcagaaggta ctggtgttat cgcaggtggt gcgatgcgtg cagtactaga agttgctggt       360
     gtacacaacg tactgtctaa agcgtacggc tctactaacc caatcaacat cgttcgtgca       420
     acgattgatg cgctagtaga cgttaagtca ccagaaatgg ttgctgctaa acgtggtcta       480
     actgttgaag ctatttcgga gtaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page