(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0396

BA000037.VV0396      Location/Qualifiers
FT   CDS_pept        394867..395223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0396"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93160"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93160"
FT                   /db_xref="GOA:Q7MPG7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG7"
FT                   /protein_id="BAC93160.1"
FT                   /translation="MARIAGINIPDQKHAVIALTAIYGIGKTRSKAILADVGIAEDVKI
FT                   SELTEEQIDQLRDGVAKYTVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
     atggcccgta ttgcaggcat taacattcct gatcagaaac atgctgtaat cgctctaact        60
     gcgatctacg gtatcggtaa aactcgctca aaagctatcc tagctgacgt gggtattgct       120
     gaagatgtta agatcagtga actaactgaa gagcagatcg atcaactgcg tgatggtgta       180
     gctaagtaca ctgtagaagg tgatctacgt cgtgaagtat ctatgaacat caagcgtctt       240
     atggaccttg gctgttaccg tggtcttcgt catcgtcgca gtctacctct acgtggacag       300
     cgtactaaaa ccaacgctcg cacccgcaag ggtccgcgta agccgatcaa gaaataa          357
//

If you have problems or comments...

PBIL Back to PBIL home page