(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0408

BA000037.VV0408      Location/Qualifiers
FT   CDS_pept        complement(401590..402153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0408"
FT                   /product="cAMP-binding protein"
FT                   /note="catabolite gene activator and regulatory subunit of
FT                   cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93172"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93172"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7K6"
FT                   /protein_id="BAC93172.1"
FT                   /translation="MDTRFTQQLQQLNLSADDIALVLSHAKELQLPTRHILHHQGEYPQ
FT                   QFYFLLDGLCHACYLTEEGKEFSKEFYWEVDWMIGFESAILQQASPFLLETLTPVHLLT
FT                   FPIELLQHWRSTHHPLYTHLLETQLVYKERKERFLLLHTPEQKYHLFKTSFPTLLERLS
FT                   DRQIAAYLGITPVSLSRIKNRSTV"
     atggacactc gctttacaca acagcttcag cagctcaatt tatccgccga tgacattgct        60
     ctagtgctct ctcacgccaa agagttgcaa ttacccactc gtcatattct ccatcatcag       120
     ggagagtatc cgcagcaatt ttattttttg ctcgatgggt tgtgccacgc ctgctatctc       180
     accgaagaag gtaaagaatt cagcaaagaa ttctattggg aagtcgattg gatgatcggt       240
     tttgaaagcg caattttgca acaagcgagc ccttttctgc ttgagacatt aacaccagtg       300
     catttactga catttcctat cgagttactg cagcattggc gctcaacgca tcacccgctt       360
     tacacgcact tactcgagac tcaactggtt tacaaagaac gtaaagagcg ctttttgctg       420
     cttcacactc ctgagcaaaa ataccacttg tttaaaacgt cgttccccac gttattggaa       480
     cggctcagtg atcggcaaat tgcggcgtat ttgggtatca cccctgtcag cctaagtcga       540
     atcaaaaacc gttcaacggt ttaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page