(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0411

BA000037.VV0411      Location/Qualifiers
FT   CDS_pept        405393..406301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0411"
FT                   /product="sulfate adenylate transferase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93175"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93175"
FT                   /db_xref="GOA:Q7MPF3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPF3"
FT                   /protein_id="BAC93175.1"
FT                   /translation="MDQQRLTHLKQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVMLH
FT                   LARKAFYPGKIPFPLLHVDTDWKFREMIEFRDRTAEKYGFELLVHKNPEGLAMGCSPFT
FT                   HGSSKHTDIMKTQGLKQALNKYGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDPKNQ
FT                   RPELWKTYNGQVNKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLAAKRPVVERDGM
FT                   LIMVDDDRMKLKEGEVIEEKSVRFRTLGCYPLTGAIESEANTLTGIIEEMLVATSSERQ
FT                   GRAIDHDQSGSMELKKRQGYF"
     atggatcaac aacgcctgac tcacttgaag cagctggaag cagaaagcat tcacattatt        60
     cgtgaagtgg ctgctgagtt cgacaatcca gtaatgatgt actcaatcgg caaagactct       120
     tcggtcatgc tgcatttagc acgcaaagcc ttctatccag ggaagattcc tttcccacta       180
     ctgcatgtag atacggattg gaaattccgc gaaatgatcg aatttcgtga tcgtacggca       240
     gagaagtacg gctttgaatt gttggtacat aagaacccag aaggcctcgc tatgggatgt       300
     agcccattta cccacggctc atcgaaacat actgacatca tgaaaacgca aggtcttaag       360
     caagcattaa ataagtatgg ttttgatgct gcctttggtg gtgcgcgtcg tgatgaagaa       420
     aaatcgcgag cgaaagagcg tgtttactca ttccgcgaca aaaaccacac ttgggatcca       480
     aaaaaccagc gcccagagct gtggaaaacc tataacggcc aagtaaacaa aggcgaaagc       540
     attcgcgtgt tccctttgtc gaattggaca gaattggata tttggcaata catctaccta       600
     gagaacatcg agattgttcc gctgtatctg gctgctaaac gcccggtggt agagcgtgat       660
     ggcatgctga tcatggtgga cgatgatcgt atgaagctga aagaaggtga agtgattgaa       720
     gagaaaagcg tgcgcttccg tacccttggt tgttacccac tgacgggcgc gatcgaatca       780
     gaggcgaata cgttgacagg cattattgaa gagatgctgg tggcgacttc cagtgagcgt       840
     caaggacgag ccatcgacca cgatcaatcg ggttcgatgg aactgaaaaa acgtcagggt       900
     tacttctaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page