(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0412

BA000037.VV0412      Location/Qualifiers
FT   CDS_pept        406319..407749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0412"
FT                   /product="sulfate adenylate transferase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93176"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93176"
FT                   /db_xref="GOA:Q7MPF2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPF2"
FT                   /protein_id="BAC93176.1"
FT                   /translation="MNSAVQAQLAELGIEGYLNQHQHKSLLRFLTCGSVDDGKSTLIGR
FT                   LLHDSKQIYEDQLAAVHSDSQRVGTTGSRPDLALLVDGLQAEREQGITIDVAYRYFSTQ
FT                   KRKFIIADTPGHEQYTRNMATGASTCDLAVILIDARKGVLDQTRRHSFISNLLGLKHFV
FT                   VAVNKMDLVEFSQQRFEEIKAEYLAFSKNLRGETDIQIIPISALEGDNVVELSQQMAWY
FT                   QGPTLLEILEAVDVEKEKEAGEFRFPVQYVNRPNLDFRGFAGTISSGVVKVGDRITALP
FT                   SGKSSTVARIVTFDGDLEQAQAGLAVTLTLADEIDISRGDLIVHHGANVELTNHLAADV
FT                   VWMTEQPLQPGRDYDIKIAGKKTIGRVEHIHHQYDINNLSKHSAAELPLNGIGLCEWTF
FT                   NESIALDNYQDCADTGGFIIIDRLTNVTVGAGMVSESLTEVTKASSDFSAFELELNALI
FT                   RKHFPHWDAKDLSELLKK"
     atgaatagtg cagttcaagc tcagctcgct gagttaggta ttgaaggtta cctaaatcaa        60
     caccaacaca aatcgctact tagattcctc acatgtggct cggtagacga tggtaaaagt       120
     accctgattg gtcgtttact acacgactca aaacagattt atgaagatca acttgcggca       180
     gtgcattcag acagtcagcg cgttggcacc acgggcagtc gtccagactt ggcgttgcta       240
     gtggatggcc tacaagcgga gcgtgagcaa ggcatcacca tcgatgtggc ttaccgttac       300
     ttctcaactc agaagcgtaa attcattatc gccgatactc cggggcatga gcagtacacg       360
     cgcaacatgg caacaggcgc ttctacctgt gacctagcgg tgattctgat cgacgcgcgt       420
     aaaggtgtgt tggatcaaac gcgtcgccac tcgtttatct ccaatttgct cggcctgaaa       480
     cactttgtgg ttgccgtgaa caaaatggac ttagtggagt tttctcagca acgctttgaa       540
     gaaatcaaag cagagtacct agcgttttcg aaaaatctgc gcggtgaaac ggatattcaa       600
     attatcccca tctctgctct ggaaggcgac aacgtggttg agctgagcca acaaatggct       660
     tggtaccaag gcccgacact actcgaaatt ttggaagcgg ttgacgttga gaaagagaaa       720
     gaagcgggtg aattccgttt cccagtgcaa tacgttaatc gtccaaacct cgattttcgt       780
     ggtttcgctg gcaccatttc gtctggtgtg gtgaaggtgg gcgatcgcat tacggcgttg       840
     ccatcgggta agagctcaac cgttgcgcgc atcgtcacct tcgatggcga tcttgaacag       900
     gcgcaagcgg gtttagcggt gacgctgact ctggccgatg agatcgatat cagccgcggg       960
     gatttgattg ttcaccatgg tgcgaatgtg gagctcacta accatttggc tgcggatgtg      1020
     gtgtggatga cagaacagcc acttcagcct ggtcgtgatt atgacatcaa gattgctggt      1080
     aaaaagacca ttggtcgcgt tgagcacatt catcatcaat atgacatcaa caacctgtct      1140
     aaacacagtg cggcagagtt gccattgaat ggtattggtt tgtgtgagtg gacctttaat      1200
     gagtctatcg ctctggataa ctaccaagac tgtgctgata ccggtggttt catcatcatc      1260
     gatcgcctga caaacgtcac tgttggcgcg ggcatggtga gtgagagcct gacggaagta      1320
     accaaagcaa gcagtgattt ctccgcattt gagttggaat tgaatgcact cattcgcaag      1380
     catttcccac attgggatgc gaaagatttg agcgagctgc ttaagaagta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page