(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0416

BA000037.VV0416      Location/Qualifiers
FT   CDS_pept        411423..411545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93180"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93180"
FT                   /db_xref="GOA:Q7MPE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE8"
FT                   /protein_id="BAC93180.1"
FT                   /translation="MFCEGTMKYFGENKLKKHLSIALLLVAYLATLIYLSKFIA"
     gtgttttgtg agggaactat gaagtacttc ggagagaata agctgaaaaa gcacctatca        60
     atcgcgctac tcttggtggc ttacctagca acgttaattt atttatctaa attcattgct       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page