(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0418

BA000037.VV0418      Location/Qualifiers
FT   CDS_pept        complement(412087..413346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0418"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93182"
FT                   /db_xref="GOA:Q7MPE6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE6"
FT                   /protein_id="BAC93182.1"
FT                   /translation="MSATMTLAWKSLRNRKATAFLTVLTVAISVILLLGVEKIRTQAKE
FT                   SFANTISGTDLIVGGRSGQVNLLLYSVFRIGNATNNIDWKSYQDFANHRAVAWAIPISL
FT                   GDSHKGFRVMGTNHSYFEHFKYGSKQPLTFSQGKPFNGLFETVLGAEVAKQLGYQIGSE
FT                   IIIAHGISDVGFSRHDNLPFKVVGILAPTGTPVDKTVHVSLEAIEAIHVGWESGARLGP
FT                   SPDATQLEQKQFQPKQITAMMLGLKSRIQTFALQREINTYNQEPLSAIMPGVALHELWG
FT                   MMSVAEQALMAVSVFVVIAGLLGMLSSLLTSLQERRREMAILRAMGARPRHVFTLLISE
FT                   ASLLTLAGIVTGVAGVYGLLSIAQPIIQQQYGINITMTAISPHEWMLLAFVQTAGILIG
FT                   FIPAIRAYKQSLSDGMTIRI"
     atgagcgcaa cgatgacctt agcttggaaa agcttacgga atcgcaaagc caccgccttt        60
     ttgaccgtgc taacggtggc gatctcggtc attctgctgt tgggggtcga gaaaattcgc       120
     acgcaagcca aagagagttt tgccaatacc atttcaggca ccgatctcat cgtcggcggg       180
     cgttctggcc aagtaaacct cttactgtat tcggtatttc gcatcggcaa tgccaccaac       240
     aatattgact ggaagagcta tcaagatttt gccaaccatc gtgctgtagc gtgggctatc       300
     ccgatctcat tgggtgattc tcataaaggc tttcgcgtga tggggaccaa ccacagctac       360
     tttgaacatt tcaaatatgg cagtaagcaa ccactcacgt tttctcaggg caaaccgttc       420
     aatggcttgt ttgagacggt actcggtgcc gaggtggcga aacaactggg ctatcagatc       480
     ggcagtgaaa tcatcattgc tcacggcatc agtgacgtcg gttttagccg ccatgacaat       540
     ttgccattta aagtggtcgg catcctagcg ccaacaggca cccccgtcga caaaacggtg       600
     cacgtttcac ttgaagccat tgaagcgatc catgtcggtt gggaatcggg cgctcgactc       660
     ggcccctccc ccgatgccac tcaattggaa caaaaacaat ttcagcccaa acagatcacc       720
     gcgatgatgc tcgggttgaa atcgcgcatc caaaccttcg cactgcaacg tgaaatcaac       780
     acctacaatc aagagccgct cagcgccatc atgcctggcg tggcgctgca tgagctatgg       840
     ggcatgatgt ctgtcgccga acaagcctta atggccgtct cggtattcgt tgtcattgcc       900
     gggttgcttg gcatgctcag cagcttgctc accagcttac aagagcgtcg ccgtgagatg       960
     gccatcctac gcgcaatggg agcaaggcct cgtcatgtct tcacgttatt gataagcgaa      1020
     gccagcttac tgacactggc aggtattgtc acaggggtgg cgggggtgta cggattactt      1080
     tcgattgcgc agccaatcat tcaacaacaa tacggcatta acatcactat gacggcaatt      1140
     tctcctcatg aatggatgtt actcgccttt gttcaaactg caggcatcct catcggtttt      1200
     atccctgcaa tcagagctta taaacaatca ctcagtgatg gaatgaccat aaggatttaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page