(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0429

BA000037.VV0429      Location/Qualifiers
FT   CDS_pept        418997..422752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93193"
FT                   /db_xref="GOA:Q7MPD5"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD5"
FT                   /protein_id="BAC93193.1"
FT                   /translation="MIKVVFKWSKWISAGVMALLVLLLTLIALLLFTHPGLTSAIWVAE
FT                   KVVPQLQVGQVQGALFPKFTLRKVTFNDAELNIASSVDELTLAMNFQCLLEPKVCINEI
FT                   SIDGLALSLPQLPPSSESVEEPSEPLKSISTPVPVFLHRLALTNIQLDVLGNQISWGEL
FT                   SSALSMQGDRLVIAPTRFSDIDVTLAPSEPQAQSAAPNDAPRQDIELPEVWIPLQIVLQ
FT                   RFDVNRFTLHQETPLIVNHLALEAKAGKNRVDVETLELDMPQVSAQANAQVELKGEYPL
FT                   SLDLKAKLKETDLKGQNITLNASQSVAHLQLQSTLSGPVSAQLSATLEPLLVSLPFDVK
FT                   LSDLQTQWPLSGESDYQIKSTNLMTQGSLEGYQLALQSQLDGKEIPAITLDVHGSGDLQ
FT                   HIDLDKLNVETLGGELKGQVMANWQSLVNWQASLQLQNIQPGLQWPEAEGNISGKLATT
FT                   GSLTEKGGWKVALPELDIDGLLRGYPLNIEGSLHASDEEGNGEVYIDTERLTLSHGPNG
FT                   LTAKGQLKKEWQMDVDIHFTDLAKSVPDLSGSVVGDVDLRGALKEPDIQLALQAQNIQW
FT                   QQQASIEQLSLTGRVTPLPEPQADVTLKVAALRYQEQLIDSILLSVSGGEKQHQLSLDV
FT                   SSDLVSTSLAIHGGLQQKPQMVWSGELERMFATTQQGTWTLQQATAIKANIDQQQVDVA
FT                   AHCWQQQGSTLCLTKDIRVGEKGEAELALNQFDFAQIAMFLPPETKLDGSVDATVWAKW
FT                   APESSPQAKVSLHLPTGQVQQKIEQVVTLGWDDINLNAQLHQDQLNADWQINVSDNGDL
FT                   TGQLQVADVQASDPQLKAKLALSQFNLDFLAPLVGEYSALKALISTDLSVSGSVYHPQV
FT                   KGRFLVDDIQVNGDISPIDVKQGKLAIDFRGYDADLAANIVTPDGELNVSGEANWQQLD
FT                   NWHSKVRFFADSLKVDMPPMVKIKLVPDMTIEVNPTLAKVTGSLALPWGRIVVEELPPS
FT                   AVSVSKDQVLLNDQLEPIDKSSSMPFNVETDINISIGDDFKLAAFGLEGGLKGQLNVTQ
FT                   KDKGPFILGEVNIVDGTYRSFGQDLLIKEGKVLMNGPADQPYVAIKAIRNPENTQDDVI
FT                   AGVKVTGPATEPSITIFSEPAMPQANALSYLLRGQDIDGESGGGNAMTTALIGLSLAKS
FT                   GKVVGEIGQAFGVQDLQLDTAGSGEDSQVTVSGYIMPGLQVKYGVGIFKPLGEFTVRYR
FT                   LMKDLYLEGVSGVESAVDLLYQFEFD"
     atgatcaaag tggtgtttaa atggagcaag tggatttctg cgggtgtcat ggcgctgctg        60
     gttttgctgc tgaccttgat tgctctgctg ctctttacgc atcccggcct aacttcggcc       120
     atttgggtcg cggaaaaagt agtgccgcag ttgcaagttg gccaagtaca aggcgcgctg       180
     tttcccaagt tcacgctgag aaaagtcacc tttaatgatg ccgaactcaa catcgcttcg       240
     tctgtggatg aactgacttt agcgatgaat tttcagtgtt tgttggagcc caaagtttgc       300
     atcaatgaaa tcagtattga tggcttggcg ctctctctgc cacagttacc tcccagctca       360
     gagagcgttg aagaacccag tgaaccgctg aaaagtatca gcacacccgt gcccgtcttt       420
     ttgcatcgat tggcattgac caacattcaa ctggatgtgc tgggcaacca aatctcttgg       480
     ggagaattga gtagcgccct ctccatgcaa ggggatcgtc tggtcatcgc gccaactcgc       540
     tttagcgaca ttgatgtcac gctggccccc agcgagccgc aagctcaatc ggcggcgcca       600
     aatgacgcgc cacgacaaga tattgaactg ccagaagtat ggatcccgct acaaattgtg       660
     ttgcagcgtt ttgatgtcaa ccgttttact ttgcatcaag aaacgccatt gatagtcaat       720
     catttagcgt tagaagcgaa ggcggggaaa aaccgtgttg acgtggagac gttggagctc       780
     gacatgccgc aagtgtcggc ccaagcgaat gcgcaggttg aattgaaagg tgagtaccca       840
     ctttcattgg atctcaaagc gaaactgaaa gaaaccgacc tgaaaggaca gaatattacg       900
     ctgaatgcct cgcaaagcgt ggcgcatttg cagttgcaga gtaccttatc tgggcccgtt       960
     tccgcacagc tgtctgccac gcttgagcca ctattagtga gcttgccttt tgatgtcaaa      1020
     ctctcagatc tacagactca atggccactg agtggtgaga gtgactatca gatcaagtca      1080
     accaacctga tgacccaagg ctctcttgag ggctatcagt tggcgctgca atctcagttg      1140
     gatggtaaag agatccctgc gatcacgctt gatgtacatg gcagcggtga tctgcaacac      1200
     attgatctcg ataaactcaa tgtcgagaca ctggggggag agcttaaagg ccaagtgatg      1260
     gccaactggc aatcgttggt caattggcag gcgagcttgc agctgcaaaa tattcagcct      1320
     ggtctgcaat ggcctgaagc ggaaggcaac atcagtggca aacttgcaac cacgggctcg      1380
     ttgactgaga aaggcggttg gaaagtggcg ctgccagaac tggatattga tggtttgctg      1440
     cgtggctatc cacttaacat tgaaggttcg ctacacgctt ccgacgaaga gggtaacggg      1500
     gaagtctaca ttgatactga gcgcttaacc ttgtctcacg gtccgaatgg cttaaccgcc      1560
     aaaggtcagc taaaaaaaga gtggcagatg gatgtcgaca tccatttcac cgatttggcg      1620
     aagagcgtgc cggatctgtc tggttcggtg gttggtgacg tggatttgcg cggtgcgttg      1680
     aaagagccgg atattcaact ggcactgcaa gcacagaaca tccaatggca gcagcaagcg      1740
     agcatcgaac agttgtcgct cacaggcagg gtcacgcctt tgccggagcc acaagcggat      1800
     gtcacattga aggtggcggc gctgcgttat caagagcagt tgattgactc gattttgctc      1860
     tcggtcagtg gcggcgaaaa acagcatcaa ctgagtttgg acgtctcttc ggatctggtt      1920
     tccaccagct tggctatcca tggtggctta cagcaaaaac cacagatggt ttggtctggg      1980
     gagttggagc gcatgtttgc caccactcag caagggacgt ggaccttaca acaagcgacg      2040
     gcgattaaag ccaatattga tcagcaacag gtcgatgtcg ccgcacattg ctggcagcaa      2100
     caaggttcaa cgctttgcct aacgaaagac attcgcgtcg gtgaaaaagg cgaagccgag      2160
     ctggcattaa accaattcga tttcgctcag attgcgatgt ttttaccgcc ggaaacgaag      2220
     ctcgatggca gtgtcgatgc aacagtgtgg gcaaaatggg caccagagag ttcgccacag      2280
     gccaaagtgt cgctgcattt acccacaggt caggtgcaac agaaaattga acaagtcgta      2340
     acgctcggtt gggatgacat caatctcaat gcgcaactgc atcaagacca attgaacgcg      2400
     gattggcaga tcaatgtgag tgacaatggt gatttaacgg ggcaactgca agtggccgat      2460
     gtgcaagcca gcgatccaca actgaaggcc aagttggcac ttagccagtt caatttggat      2520
     ttcttggcgc ctttggttgg ggaatacagc gcgctgaaag cgctgatttc aaccgatctg      2580
     tcggtgtcgg gttcggttta tcaccctcaa gtaaagggcc ggttcttagt agacgatatc      2640
     caagtgaacg gtgatatcag cccaatcgac gtgaaacagg gcaaactggc gatcgatttt      2700
     cgcggttatg acgccgattt ggcggccaat attgtaaccc ctgatggaga gctcaacgtc      2760
     agtggtgagg cgaattggca gcaattggat aactggcaca gcaaggtgcg gttttttgcc      2820
     gattccctca aagtcgacat gccgccgatg gtgaaaatta agttggtgcc ggatatgacg      2880
     attgaagtta atccgacact ggccaaagtg acgggcagtt tggctctgcc ttggggacgt      2940
     attgttgtcg aagaactgcc accaagcgcg gtgagtgtgt cgaaagatca ggtgctgctc      3000
     aacgaccaac tcgagccaat cgataagtct tcctcgatgc catttaacgt tgaaaccgac      3060
     atcaacattt cgattggtga cgatttcaaa ctggcggcat ttggccttga agggggctta      3120
     aaaggccagt tgaatgtcac gcagaaagac aaagggccgt ttatccttgg tgaagtcaac      3180
     attgttgacg ggacctatcg atcctttggt caagacctct tgatcaaaga aggcaaagtg      3240
     ttgatgaacg ggcctgccga tcagccatat gtggcgatca aagcaattcg caacccagaa      3300
     aatacccaag atgatgtcat cgcgggggtg aaagtaactg gccctgccac cgagccaagt      3360
     attacgattt tctccgaacc tgccatgccg caggccaatg cgctttctta cttattgcgc      3420
     gggcaagaca ttgatggtga atcgggaggc ggcaacgcca tgaccacggc cttaatcgga      3480
     ttgagtctgg ccaaaagcgg caaagtcgtc ggtgaaattg gtcaggcgtt tggcgtgcaa      3540
     gatctgcagt tggataccgc aggttccggg gaagattcac aagtcacggt cagtggctac      3600
     ataatgccag ggctgcaagt gaagtatggg gtgggtattt tcaaaccgct tggtgagttc      3660
     accgtgcgct atcgtctgat gaaagatctc tatctagaag gggtttcagg ggttgaaagc      3720
     gccgttgatc tgctttatca gtttgagttt gattaa                                3756
//

If you have problems or comments...

PBIL Back to PBIL home page