(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0437

BA000037.VV0437      Location/Qualifiers
FT   CDS_pept        427964..428992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0437"
FT                   /product="thiamine ABC transporter, periplasmic
FT                   thiamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93201"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93201"
FT                   /db_xref="GOA:Q7MPC7"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC7"
FT                   /protein_id="BAC93201.1"
FT                   /translation="MPNGERAVKHTLNLIALASITSMMGISSSALAADKTLTIYTYDSF
FT                   ASDWGPGPTVEKAFEAQCGCDVNFVALDDGVSILNRLRLEGSNTKADIVLGLDNNLMAE
FT                   AKATGLLAQHQVETTAITLPNGWADDTFIPYDYGYFAFVYNKGKLANPPKSLKELVESR
FT                   DDLKVIYQDPRTSTPGQGLMLWMKSVYGDDVTGAWQQLAKKTVTVTKGWSEAYSMFLKG
FT                   ESDMVLSYTTSPAYHLIAENDAQYAAAGFSEGHYMQVEVAAKVKSSQNSALADQFMSFI
FT                   LSDEFQSAMPTGNWMYPVTNVTLPEGYRSLTVPEKALSFSAEEVAKQRKAWIREWQSAL
FT                   TF"
     atgccaaatg gagagcgagc agtgaaacac actctaaacc tgatagccct agcgtcaatc        60
     acgtcaatga tgggcatctc ttcttctgca cttgcggcgg acaaaacctt aaccatttac       120
     acctacgatt cttttgcctc cgattggggt cctggcccga cagtcgaaaa agcatttgaa       180
     gctcagtgcg gctgcgatgt gaattttgtc gcgctggacg atggggtgtc aattctcaac       240
     cgcttacgtt tagaaggcag caataccaaa gcggatattg ttttaggttt ggataacaat       300
     ttgatggcag aagccaaagc cacagggctg cttgcgcagc atcaagtaga aaccacggct       360
     attacgctgc cgaatggttg ggcggatgat acgtttattc cttatgacta cggttacttt       420
     gcgtttgttt acaacaaagg caaactggcg aatccaccca aaagcctaaa agagctggtg       480
     gaatcacgcg acgatctgaa agtcatctac caagaccctc gcacttcaac gcccggtcaa       540
     ggtttgatgc tgtggatgaa gtcggtgtat ggcgatgacg tgactggagc atggcagcaa       600
     ctggcgaaga aaaccgtgac ggtcacgaaa ggttggtcgg aagcgtattc gatgttcctc       660
     aaaggcgaat cggacatggt gctctcttac accacctcac ctgcgtacca cctgattgcc       720
     gaaaatgatg cacaatatgc cgcggcgggt tttagtgaag ggcactacat gcaagtggaa       780
     gtcgccgcaa aagtgaaaag tagccagaac tctgcgctgg ctgatcagtt tatgagtttc       840
     attttgagtg atgagttcca aagcgcaatg cctacgggca actggatgta cccagtgacc       900
     aacgtgacgc tgccagaggg ctaccgcagt ttaaccgtgc ctgagaaggc gttgagtttc       960
     agtgcggaag aggtggcgaa gcagcgtaaa gcttggattc gcgaatggca aagcgcgttg      1020
     acgttttaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page