(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0439

BA000037.VV0439      Location/Qualifiers
FT   CDS_pept        430603..431307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0439"
FT                   /product="thiamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93203"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93203"
FT                   /db_xref="GOA:Q7MPC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPC5"
FT                   /protein_id="BAC93203.1"
FT                   /translation="MLTLQQVHYYYHQDLFAFDLEVEAGSIVALMGPSGAGKSTLLALL
FT                   AGFIAPQSGQMALDGRLLNTLSPAQRPFSMLFQEHNLFAHLTVRDNIALGLHPGLKLTS
FT                   QQQKQVEQAAKQVGIEAYLDRLPEQLSGGQRQRVALARCFVQPNPIWLLDEPFSALDPV
FT                   LRDEMLSLVKQLAQERAITVLMVTHHLSDARAIASHFAYIDKGTIAAHGPIASLNEKHS
FT                   HPELVEFFQAAV"
     atgctaacgc tgcaacaggt gcattattat tatcatcaag atctgtttgc ttttgattta        60
     gaggtagaag caggcagtat tgtggcgttg atggggccaa gtggggcagg aaagtccacc       120
     ttgctggcgc tgctggcggg gttcattgcg cctcagtcgg gccaaatggc attggatgga       180
     cgcttgctca atacgctttc tccagcgcag cgtcctttct cgatgttgtt tcaagaacac       240
     aatttgtttg ctcatctcac ggtgcgcgac aacattgcgt tgggattgca tcccggtttg       300
     aaactgacgt cgcagcaaca aaagcaagtg gagcaagcgg caaagcaggt tggcattgaa       360
     gcctatttag atcggctgcc tgaacagctc tctggtggtc agcgacagcg agtggccctt       420
     gcgcgttgtt ttgtccagcc caacccaatt tggttactgg atgagccgtt ttccgcgctc       480
     gatccagtct tgcgtgacga aatgctctcg ctcgtcaaac agctggcgca agagcgcgcg       540
     attacggtct tgatggtgac gcatcattta agtgatgcac gtgccattgc tagccacttt       600
     gcctacatag acaagggcac cattgccgcg catgggccta ttgcgagcct caatgaaaag       660
     cacagccatc cagagttggt agagtttttc caagctgcag tatga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page