(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0440

BA000037.VV0440      Location/Qualifiers
FT   CDS_pept        complement(431401..431958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93204"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93204"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPC4"
FT                   /protein_id="BAC93204.1"
FT                   /translation="MARKNQKAPWEPEEEYILVSKSEMKRDMDALQKLGEELVELKPSV
FT                   LAKFPISEELLDAIKDAQRFKNEARRRQLQYIGKVMRQEDPEPIQAALDKIRNKHSQNT
FT                   AVLHKLETLRERIVEQGDSAIDDVVALYPDADRQRLRQLARMATKEKQANKPPKAYREI
FT                   FQILKQLNDDAVSDSIENELKQ"
     atggcccgta aaaaccaaaa agcgccatgg gaaccggaag aagagtacat cctcgtcagc        60
     aagtctgaaa tgaagcgtga catggacgcg ctacagaagt tgggtgaaga gctagtggaa       120
     ctcaaacctt cggtattggc taagttccca atcagcgaag agttacttga tgctatcaaa       180
     gatgcgcagc gtttcaaaaa cgaagcccgt cgtcgccagt tgcaatacat tggcaaagtg       240
     atgcgccaag aagatccaga gccaattcaa gcggcgctgg acaaaatccg taacaagcac       300
     tcgcagaaca ccgccgtgct acacaagcta gaaacgctgc gtgaacgtat tgttgagcaa       360
     ggtgacagtg caattgatga tgtggttgcc ctttaccctg atgcggatcg tcaacgccta       420
     cgccagctag cacgtatggc gacgaaagag aagcaagcga ataagccgcc aaaggcctac       480
     cgtgaaatct tccaaatctt aaaacagctt aatgatgatg cggtttcaga ctcgatcgaa       540
     aacgagctaa aacagtaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page