(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0441

BA000037.VV0441      Location/Qualifiers
FT   CDS_pept        432076..433419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0441"
FT                   /product="pmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93205"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93205"
FT                   /db_xref="GOA:Q7MPC3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC3"
FT                   /protein_id="BAC93205.1"
FT                   /translation="MDVKQQVAQQRVELEAAVAKALALAAQHSDGAEVAINKTTGLSVS
FT                   TRMCEVENVEFNSDGALGITVYRGQRKGSASTSDLSEKAIEQTVLAALDIAQYTSEDPC
FT                   AGPAPAELMVKEIPDLDLFHPDTPDPDYAAKMAIAAEEHALNYSDKIKQSDGASYDSHY
FT                   GVRVYGNSHGLLASYASSRHSISCCVIGEGKNGEMERDYSYTVARHRDDMWRPEQVGRE
FT                   AAQKTIERLDARKLKTGKYPVMFAADVATGLIGHLVMAISGGNLYRKSSFLLDHLGKQV
FT                   LPEWFNISERPHILRGLASSPFDSEGVYTQDREIITDGVLATYLLTSYAARKMNMAPTG
FT                   HAGGIHNWFVQSTGQDFQQMLKELGTGLLVTEVMGQGVNVVTGDYSRGAAGFWVENGEL
FT                   QFPVSEITIAGNLKEMFQQIVAVGSDVETRSQVQTGSILLPSMKIAGE"
     atggatgtaa aacagcaagt tgctcagcaa agagttgagc tcgaagccgc ggttgccaaa        60
     gcgctcgcgc tggcagcgca acatagcgat ggtgctgaag ttgcgatcaa caaaaccacg       120
     ggcttaagtg tttcgactcg catgtgtgaa gtagaaaacg tcgagtttaa cagtgatggc       180
     gctttaggca ttacggttta tcgtggtcag cgtaaaggca gcgcgtcgac atcggatctc       240
     agtgaaaaag cgattgaaca gactgtcttg gcggccttgg atattgcgca atacacgtca       300
     gaagatccct gtgctgggcc tgctccagct gagttgatgg tgaaagagat tccggatttg       360
     gatctcttcc atccagatac gcccgatccc gattatgcgg cgaaaatggc cattgctgct       420
     gaagagcatg cgcttaacta cagcgataaa attaagcaga gtgatggcgc gagttacgac       480
     agccattacg gcgttcgcgt ctacggcaac agtcacggct tattggcaag ttatgcctcg       540
     agtcgccata gcatcagttg ttgtgtgatt ggtgaaggca aaaatggcga aatggagcgt       600
     gactacagct acactgtcgc ccgtcatcgt gatgacatgt ggcgtcctga acaagtcggt       660
     cgcgaagcgg cgcaaaaaac cattgaacgt ttagatgccc gcaagctaaa aacgggcaaa       720
     tacccggtga tgtttgccgc ggatgtggca accgggctta tcggccattt agtgatggcg       780
     atcagtggcg gtaacttgta tcgcaaatcg tctttcttgc ttgatcattt gggcaagcaa       840
     gtgctgccag agtggttcaa tatctctgag cgtccgcata ttctgcgtgg tttggcatca       900
     agcccattcg acagcgaagg ggtttacacg caagatcgcg aaatcatcac cgatggtgtg       960
     ctcgccactt atctgctcac cagttacgct gcgcgtaaaa tgaatatggc gccaacggga      1020
     catgcaggtg gtatccacaa ttggtttgtg caatcgacag ggcaagattt ccaacagatg      1080
     ctcaaagagc tgggtacggg tttacttgtg accgaagtga tgggtcaagg tgtgaatgtg      1140
     gtgaccggcg attattcgcg tggcgcggcg ggtttctggg tggaaaatgg cgagttgcaa      1200
     ttcccagtgt cagaaatcac cattgcgggt aatttgaaag agatgttcca gcaaatcgtt      1260
     gccgttggta gcgatgtaga gacgcgctca caagttcaaa ccggttctat tttgttgcca      1320
     tcgatgaaga ttgcgggcga ataa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page