(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0445

BA000037.VV0445      Location/Qualifiers
FT   CDS_pept        complement(435370..436233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0445"
FT                   /product="predicted P-loop-containing kinase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93209"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93209"
FT                   /db_xref="GOA:Q7MPB9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPB9"
FT                   /protein_id="BAC93209.1"
FT                   /translation="MRLIVVSGHSGAGKSVALRVLEDMGYYCVDNLPVNLLESFIQSVS
FT                   ESKQNVAVSIDVRNIPKKLKELTTTLQKLKSSIDLSILFLDADKATLLKRYSETRRVHP
FT                   LSLSDECHTLDQAIDLEKKMLKPLKEIADILLNSSNQSLHDLSEDVRYRIEGKERNKLI
FT                   MVFESFGFKFGLPTDADYVFDVRFLPNPHWEPALRPMTGLDAPIKTFLESHDEVLELKR
FT                   QIQTFIEHWLPLLEKNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFAAMGHTVKIRHTTL
FT                   EKRNKE"
     atgcgtctta ttgtagtgag tgggcactcc ggtgcaggga aaagtgtcgc gctacgtgtg        60
     ttagaagata tgggttacta ctgcgtagat aacctcccgg ttaacctgct ggaatctttc       120
     atacaatcag tttcggaaag taaacagaat gtcgcggtca gtattgacgt tcgcaacatt       180
     ccgaagaaac tgaaagagct gacaacaacg ctacaaaagc tgaaatccag cattgacctt       240
     tcgattctct ttttagatgc ggataaagct acccttctca aacgctacag tgagactcgc       300
     cgcgttcacc ctctttcttt aagtgatgag tgccataccc tagatcaagc gatcgacctt       360
     gagaaaaaaa tgctcaagcc attgaaagag atcgccgata tcttactcaa cagcagtaac       420
     caatcactgc acgatctcag tgaagacgtt cgctaccgca ttgaaggaaa agagcgtaat       480
     aagctcatca tggtgttcga gtcttttggc ttcaaatttg gtttaccaac agatgccgac       540
     tacgtgtttg acgtccgctt tctgcccaac cctcattggg aacctgcgtt gcgcccgatg       600
     acggggttgg atgcgcccat caaaaccttc ttagaaagcc atgatgaagt gttagaactc       660
     aaaaggcaga ttcaaacctt tatcgagcac tggttgcctt tgctggaaaa aaacaatcgc       720
     agctatttaa ccgtggcgat tggctgtacg ggagggaaac atcgctccgt ctacttaact       780
     cagcaaatcg gcgaatattt cgcggcgatg gggcacaccg ttaagattcg ccacaccact       840
     ttggaaaaac gcaacaagga atag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page