(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0451

BA000037.VV0451      Location/Qualifiers
FT   CDS_pept        complement(439723..440286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93215"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93215"
FT                   /db_xref="GOA:Q7MPB3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB3"
FT                   /protein_id="BAC93215.1"
FT                   /translation="MSFSRLIYLLLFFVVSWSCYYLYGQREAQSVQVAPNLELPMFSGE
FT                   SLNNISYNSDGIRSHQISSSHLDHYAKSGDTVFENPSLVIYRDGDTIEWKITARRAVLD
FT                   EEQVLTLSDHVRMQNLLPGASFEMLSTDKLEIDLSNRDFHADQPVLLIGPQFETTGEAM
FT                   KGNLKTNTATLYNHVQGRYETLTP"
     atgagttttt ctcggctgat ttatttactg ctgtttttcg ttgtgagttg gtcttgctac        60
     tacttgtatg gccaacgtga agctcaatct gtacaagtgg cacccaattt agagctaccg       120
     atgtttagtg gcgaatcact caataacatc agctataact ctgatggcat acgaagccat       180
     cagatctctt cgtcacattt ggatcactat gccaaaagtg gcgataccgt ttttgaaaat       240
     ccgagtttag tcatctaccg cgatggcgac acgatcgaat ggaaaatcac agctcgacgc       300
     gccgtgctgg atgaagaaca agttttgacc ctctccgacc acgtgagaat gcaaaacttg       360
     ttgccaggtg ccagcttcga aatgctgtct acggacaaac tggaaatcga tctgtcaaat       420
     cgagattttc atgctgacca gccggtttta ttgattggtc cacaatttga aaccaccgga       480
     gaagcgatga agggtaacct gaaaaccaac acagcgactc tgtataatca tgtacaaggt       540
     agatatgaaa cccttacacc ttag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page