(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0468

BA000037.VV0468      Location/Qualifiers
FT   CDS_pept        complement(455011..455145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93232"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93232"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP96"
FT                   /protein_id="BAC93232.1"
FT                   /translation="MLSRILSTTNKKADPTIGFVFLTLTFADLLYEVHANLNVTVKRF"
     ttgttgagtc gaatactatc aaccacaaac aaaaaagccg atccaacgat cggctttgtt        60
     tttctaacac tcacattcgc tgacttactt tacgaagtcc acgccaattt gaatgtcacc       120
     gttaagcgtt tctag                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page