(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0479

BA000037.VV0479      Location/Qualifiers
FT   CDS_pept        complement(462436..463458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0479"
FT                   /product="pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93243"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93243"
FT                   /db_xref="GOA:Q7MP85"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP85"
FT                   /protein_id="BAC93243.1"
FT                   /translation="MRLSKSSTRKKTMVKRLVVTAGEPAGIGPDLVLALSKEHWPHQLV
FT                   VCADKKMLAQRAEQLGINVTLLDYDASTAPSPQQAGTLVVEHIDMPSTCVAGQLNEENG
FT                   HYVLKTLERAALGCMKSEFDAIVTGPVHKGVINRAGVAFSGHTEFFAELSNTPLVVMML
FT                   ATEGLRVALVTTHIPLAYVSKAVTAERLQKIIDILHRDLVEKFAIAEPKIYVCGLNPHA
FT                   GEDGCLGREEIETITPTLEKIRQEKGIHLLGPLPADTIFNEKYLNDADAVLGMYHDQVL
FT                   PVLKYKGFGQSVNITLGLPFIRTSVDHGTALDLAGTGQANTGSFRTALQHAIELVEKKQ
FT                   "
     gtgcgtttgt cgaaatcatc aacgaggaag aaaacgatgg ttaaacgctt agtggtgaca        60
     gctggagaac ccgctggcat tggtcccgat cttgttctcg ctttatcaaa agagcattgg       120
     ccacaccagt tagtggtgtg tgcagataaa aaaatgctcg cccaacgtgc agagcaattg       180
     gggattaacg ttaccctgct tgattatgat gcttcaactg ccccctcccc ccaacaagcg       240
     gggacattag tggtcgagca tatcgatatg ccgagcactt gtgtggcagg gcagctcaat       300
     gaagagaatg gtcattatgt attaaaaacg ctggaaagag ccgctttagg ctgtatgaaa       360
     agcgaatttg atgctattgt caccggccct gttcacaagg gggtgattaa ccgagctggg       420
     gttgctttta gcggccatac cgagtttttt gccgagctat caaacacgcc tcttgtggtc       480
     atgatgttag ccaccgaagg cttaagagta gcgcttgtca cgacacatat tccattggcg       540
     tatgtgtcga aagcggtcac tgcagagcga ttgcagaaga tcatcgatat tttgcatcgc       600
     gacttagtag aaaaattcgc cattgccgag cctaagattt acgtgtgtgg attaaacccg       660
     cacgcaggag aggacggatg cttaggccgt gaagagattg aaaccatcac gccgacgctg       720
     gaaaaaattc gtcaagaaaa aggaatccat ctgctaggcc cattgccagc agacaccatt       780
     ttcaatgaaa aatatttaaa cgatgccgat gctgttctag gaatgtatca cgaccaagtc       840
     ttgcctgtgt tgaaatacaa gggatttggt cagtcggtca acattactct tggtctaccc       900
     tttataagaa catcggtaga tcacggaact gcactcgatt tagccgggac tggccaagcg       960
     aatacaggga gcttccgaac agcacttcag catgcgatag aactggtaga gaaaaaacaa      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page