(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0482

BA000037.VV0482      Location/Qualifiers
FT   CDS_pept        467230..468093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0482"
FT                   /product="DnaJ-domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93246"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93246"
FT                   /db_xref="GOA:Q7MP82"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP82"
FT                   /protein_id="BAC93246.1"
FT                   /translation="MQIFGKILGAFFGFLFGGVFGALFGLFIGHQFDKARRLSQAGFKT
FT                   AGFGQGPSQAQRQEEFFKSAFAVMGHVAKAKGQVTKEEIQLASAMMDRMSLHGEQRRAA
FT                   QDAFREGKERDFPLEQLLERVKIATSGRFDLLQFFLELQISAAFADGDVHPSERNVLHK
FT                   IARGLGFSSEQLERRLQMQEAAFRFQRQGGFGGQQHQSHHSSSHGGWQQASQTDRLADA
FT                   YKILGIDANADGKEVKRAYRKLMNEHHPDKLMAKGLPPEMMNMAKEKSQEIQSAYDLIK
FT                   KEKGFK"
     atgcagattt ttggcaaaat tcttggtgcc ttttttggtt ttttgttcgg cggggtgttt        60
     ggggcactgt tcggtttatt tattggtcac cagttcgaca aagcacgacg cttgagtcaa       120
     gcgggcttta aaaccgcagg ttttggccaa gggccaagtc aagctcagcg acaagaggag       180
     ttttttaagt ccgcttttgc tgttatgggg catgtggcta aagcaaaagg ccaagtcacc       240
     aaggaagaga tccaacttgc cagtgcaatg atggatcgaa tgagcttgca tggcgaacag       300
     cgcagagcag cgcaagatgc gtttcgtgaa ggtaaagaac gtgatttccc tctggaacaa       360
     ctcttagaga gagtcaaaat tgccactagt ggccgttttg atttattgca gttctttttg       420
     gaattacaga tctctgcggc ttttgccgat ggcgatgtgc atccaagtga aagaaacgta       480
     ttgcacaaga ttgcgcgagg tttaggattt tcgtctgaac agctcgagcg tcgtttgcag       540
     atgcaagaag cggcatttcg tttccaacgt cagggcggat ttgggggaca acagcatcaa       600
     tctcatcact catcttctca cggtggctgg cagcaagcgt cgcaaactga ccgtctcgcg       660
     gatgcctata agatcttggg cattgacgcc aatgccgatg gcaaagaggt gaagcgcgct       720
     tatcgtaagt taatgaatga gcaccaccct gataaattga tggcaaaagg tctaccgcca       780
     gaaatgatga atatggcgaa agaaaaatcg caagaaattc aaagtgctta cgatcttatt       840
     aagaaagaaa aaggcttcaa gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page