(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0483

BA000037.VV0483      Location/Qualifiers
FT   CDS_pept        complement(468178..468984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93247"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93247"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP81"
FT                   /protein_id="BAC93247.1"
FT                   /translation="MLCRGYFPMRRYLLLIFTLFSVASYAAPKSDLWPYWQPSDEQSTI
FT                   KVSHQAWQTLLDRYLIRQGENTLFRYAQVSTQDHQTLKQYLTTLAKQNPLTLNRAEQYA
FT                   YWVNLYNAITVDLILDNYPLKSITKLGGLFSFGPWNEEVITINSKPLTLNDIEHRILRP
FT                   IWNDPRTHYAVNCASLGCPNLQPQAFTADNTPALLDAAAKEFINSAKGVSRQGNKAQLS
FT                   SIYDWFADDFGGKAGLFSHIGRYAPQYQDFSGQIEYDYDWNLNQAQ"
     atgctttgta gaggatattt cccgatgcga cgatatttac tgctgatttt caccttgttt        60
     tctgttgcga gttacgcggc accaaagtcg gatctttggc catattggca accatccgac       120
     gagcaaagca ccatcaaagt atcccatcaa gcttggcaaa cactgctcga tcgctatttg       180
     attcgccaag gagaaaatac actttttcgc tatgcacaag tgtcgacaca agaccatcag       240
     acccttaagc aataccttac tacgctggct aagcaaaatc cgctgacact caaccgcgca       300
     gagcaatatg cctattgggt gaatctctac aatgcgatca ccgttgatct tatcctcgac       360
     aattatccgc tcaagtctat taccaagtta ggtggtttgt ttagctttgg accgtggaat       420
     gaagaagtca tcaccatcaa tagcaagcca ttaacgctca acgacatcga acatcgtatt       480
     ttgcgcccga tctggaatga tcctcgcacc cattatgcgg tcaactgcgc cagcctaggt       540
     tgtcctaacc tgcaaccaca agcctttaca gccgataaca caccggcttt gctcgatgcg       600
     gcagcgaaag agtttatcaa tagtgccaaa ggcgtatcac gacaaggtaa taaagcgcag       660
     ctctcttcaa tatacgattg gtttgcggat gattttggtg gaaaagcggg attattttcc       720
     cacattggcc gctatgcgcc acagtatcaa gatttttctg gtcaaatcga gtacgactat       780
     gactggaatc tcaaccaagc ccaataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page