(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0485

BA000037.VV0485      Location/Qualifiers
FT   CDS_pept        complement(469708..471108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0485"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93249"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93249"
FT                   /db_xref="GOA:Q7MP79"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP79"
FT                   /protein_id="BAC93249.1"
FT                   /translation="MGKTLYEKVYEAHVAVAAEGETPILYIDRHLVHEVTSPQAFDGLR
FT                   EKGRQVRQVSKTFATMDHNVSTTTKDINASGEMARIQMETLIKNCQEFGVTLYDINHKY
FT                   QGIVHVMGPELGITLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLATQTLKQARA
FT                   KTMKIEVQGKVADGITAKDIVLAIIGKTTAAGGTGYVVEFCGEAITDLSMEGRMTVCNM
FT                   AIELGAKAGLIAPDKTTFDYIKGRKFAPTGADWDAAVEYWKTLKTDEDAKFDAVVTLNA
FT                   ADIKPQVTWGTNPGQVIAVDEPIPAPESFSDPVEKASAEKALAYMGLEAGKSLSEYKVD
FT                   KVFVGSCTNSRIEDMRAAAVVAKGRKVASHVQALIVPGSEQVKAQAEAEGLDVIFKEAG
FT                   FEWRLPGCSMCLAMNNDRLGPHERCASTSNRNFEGRQGRDGRTHLVSPAMAAAAAIAGH
FT                   FVDIRDWK"
     atgggcaaaa cactatacga aaaagtttat gaagcacacg tcgcggttgc cgcagaaggt        60
     gagacgccga tcctatatat cgaccgtcat ttagtgcatg aagtgacttc tccacaagcg       120
     tttgatggct tacgtgaaaa ggggcgccaa gtgcgtcaag tgagcaaaac gttcgcgacc       180
     atggatcata acgtatccac caccaccaaa gacataaatg cgtctggtga aatggcccgt       240
     attcagatgg aaaccctgat caaaaactgt caggaattcg gtgtcacctt gtacgacatc       300
     aaccataaat atcaaggcat tgtgcatgtt atggggccag aattgggcat cactttacca       360
     ggcatgacca ttgtctgtgg tgattctcac accgcaacac acggtgcgtt tggttcgctg       420
     gcatttggta ttggtacttc tgaagtcgag catgtgctgg caacacaaac ccttaagcag       480
     gcgcgcgcca aaaccatgaa aatagaagtt caaggcaaag tcgctgacgg tatcacggcc       540
     aaggacatcg tccttgccat cattggcaaa accaccgccg cgggtggaac gggctatgta       600
     gtggagtttt gtggtgaagc aattacagac ctttccatgg aaggccgcat gaccgtgtgc       660
     aatatggcaa ttgagttagg tgccaaagca ggcttgattg caccagacaa gaccaccttc       720
     gactacatca aaggtcgtaa attcgcgcca actggcgcag attgggatgc ggcggttgaa       780
     tactggaaaa cactcaaaac cgatgaagac gctaaatttg atgccgtggt gacgttaaac       840
     gctgccgata tcaaacctca agtgacgtgg ggcacgaacc caggccaagt gattgccgtg       900
     gatgagccca ttccagcacc agaaagcttc agcgatcccg ttgaaaaagc gtccgctgaa       960
     aaagcactgg cgtacatggg actggaagcc ggtaaatcgc tgtccgaata caaagtcgac      1020
     aaagtctttg tcggctcttg cacaaactca cgtatcgaag atatgcgcgc cgccgctgtc      1080
     gtcgccaaag ggcgcaaagt ggcatcacac gttcaagcgc tgattgttcc ggggtctgag      1140
     caagtcaaag cgcaagccga agcagaaggt ttggatgtca ttttcaaaga agcgggtttt      1200
     gaatggcgac tacctggttg ctctatgtgc ctagcaatga acaatgatcg tctagggcca      1260
     catgagcgct gtgcgtcaac ttcaaaccgt aactttgaag gccgccaagg ccgtgatggt      1320
     cgtacacatc tagtgagtcc agccatggct gccgcggcgg caattgctgg tcattttgtt      1380
     gatattcgag attggaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page