(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0495

BA000037.VV0495      Location/Qualifiers
FT   CDS_pept        480810..482534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0495"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93259"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93259"
FT                   /db_xref="GOA:Q7MP69"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP69"
FT                   /protein_id="BAC93259.1"
FT                   /translation="MTAMLSGAEMVVQSLIEENVEQIFGYPGGSVLDIYDALHAKTEQI
FT                   KHVLVRHEQAATHMADGYARATGKPGVVLVCSGPGATNTITGIATAYMDSIPMIVISGN
FT                   VPNSLIGNDAFQECDIVGVSRPVVKHSFLVKRAEDIPETIKKAFYIATTGRPGPVVIDL
FT                   PKDVMNPLIKLPYEYPKSISMRSYKPTTSGHKGQIKKALKALLEAKKPVLYIGGGAIIS
FT                   GAHESILKLAETLNLPVVSTLMGLGAFPGTHKNALGMLGMHGKYEANMAMHNADLIFGV
FT                   GVRFDDRTTNNLEKYCPNAKIMHIDIDPSSISKNVKVDLPIVGSAEQVLETMVTLLEEQ
FT                   GAENDTQALASWWDEIEGWKARDCLAYDTSSERIKPQQVIETLHKLTNGDAYVASDVGQ
FT                   HQMFAALYYPFNKPRRWINSGGLGTMGFGLPAGMGVKFAMPEEEVVVVTGDGSIQMNIQ
FT                   ELSTAMQYDIPVKIINLNNRFLGMVKQWQDIIYQGRHSNSYMSSVPDFAAIAEAYGHVG
FT                   IRIETPDQLESELKRALDMKDRLVFVDINVDETEHVYPMQIKGEGMDKMWLSKTERT"
     atgacagcaa tgttgtcagg cgcagagatg gttgttcaat ctctgatcga agaaaacgta        60
     gagcaaattt ttggttatcc cggtggttca gtactggata tttatgatgc tcttcacgcc       120
     aaaactgaac aaatcaagca tgtattagtt cgtcatgaac aagccgcgac ccacatggct       180
     gatggttatg ctcgtgccac aggcaaacct ggcgttgtcc tagtctgttc aggacctggc       240
     gcaacgaaca ccatcaccgg aattgccacg gcttacatgg attccatccc gatgatcgtt       300
     atttcaggaa acgtacccaa tagcttaatt ggtaatgatg ctttccaaga gtgcgatatc       360
     gttggtgttt ctcgccctgt ggttaaacat agtttcctcg ttaagcgtgc ggaagacatt       420
     ccagagacca tcaagaaagc attttacatt gccacgacag gtcgccctgg ccctgtggtg       480
     atcgacttgc caaaagatgt gatgaacccg ctgatcaaac tgccttatga atatcctaag       540
     tcaatcagca tgcggtcata caaaccaacc acttcgggcc ataaaggcca aatcaagaaa       600
     gcgctaaagg cattacttga agcgaagaag cccgttcttt atatcggtgg tggagcgatt       660
     atctcaggtg cgcatgagtc gatcctcaag ctggctgaaa cattaaattt gcccgttgta       720
     agcacactaa tggggctcgg tgctttcccg gggacccaca aaaacgctct aggcatgctc       780
     ggcatgcatg gtaaatatga agccaatatg gcgatgcata acgccgatct tatttttggt       840
     gttggggtac gttttgatga ccgtaccacc aacaacttag aaaaatactg ccctaatgcg       900
     aagatcatgc acatcgatat cgacccttct tcgatctcga agaatgtcaa agttgaccta       960
     cccatcgtgg ggtcagcgga gcaagtgctt gagaccatgg tgacacttct tgaagagcaa      1020
     ggcgctgaaa acgatacgca agccttagcg agctggtggg atgaaattga aggctggaaa      1080
     gcacgagatt gcctcgccta cgacacctct tcggagcgca tcaagccaca acaagtgatc      1140
     gagacactgc ataagctgac caatggggat gcttatgttg cgtcagatgt aggccagcat      1200
     caaatgtttg ccgcgcttta ctacccgttc aacaaaccgc gccgttggat caattctggt      1260
     ggtctaggca cgatgggctt tggtttgccc gctggtatgg gggtgaaatt cgctatgcca      1320
     gaagaagaag tggtggtggt gacgggggat ggcagtatcc aaatgaacat tcaagaactg      1380
     tcgactgcca tgcaatatga cattccggtc aaaattatca acttgaataa ccgtttccta      1440
     gggatggtga aacagtggca agacattatc tatcaaggtc gccactctaa ctcatacatg      1500
     agttctgttc ctgattttgc agccattgca gaagcttatg gccatgtagg tattcgcatt      1560
     gaaacccccg atcaactcga gtcagagctt aaacgcgccc tcgacatgaa agatcgcttg      1620
     gtgtttgtcg atatcaatgt ggatgaaact gagcacgtct acccaatgca aatcaaaggc      1680
     gaaggcatgg acaaaatgtg gctaagcaaa acggagagaa cttaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page