(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0498

BA000037.VV0498      Location/Qualifiers
FT   CDS_pept        485309..485440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93262"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93262"
FT                   /db_xref="GOA:Q7MP66"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP66"
FT                   /protein_id="BAC93262.1"
FT                   /translation="MLNHFLVRLTIGTLVVLGFKLSAIYFLLLILLLNTHHKEFFGW"
     atgttaaacc attttttagt tagattgacc attggaaccc tagtggtact tggatttaaa        60
     ttgagcgcaa tttacttctt attgttgatc cttttgctca acacgcatca caaagagttt       120
     tttggttggt ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page