(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0506

BA000037.VV0506      Location/Qualifiers
FT   CDS_pept        496322..496480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP57"
FT                   /protein_id="BAC93271.1"
FT                   /translation="MIVGMTSSFVLLFANRFKLDDFFVNRIKNSLMDCDKTNICHIEQN
FT                   MHIASVI"
     ttgattgtcg gcatgacgtc ctcgtttgtg ttgttgtttg ccaacagatt caaattagat        60
     gattttttcg tcaatagaat aaaaaacagt ctaatggact gtgataagac gaatatctgt       120
     catattgaac aaaatatgca catagcatcg gtgatttga                              159
//

If you have problems or comments...

PBIL Back to PBIL home page