(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0509

BA000037.VV0509      Location/Qualifiers
FT   CDS_pept        498755..499471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93273"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93273"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP55"
FT                   /protein_id="BAC93273.1"
FT                   /translation="MREMTTKAALILGVSLIVGLGVLGYLVQQTAIQYKALDRIVTVKG
FT                   LSEREYPADTVIWPIRFTVASNDIQDLFTKVDTQSTLITDFLNKRELSDSVQWSAPAVI
FT                   DKKAQQYGGEANAEYRYLAIQTITVYSNKVDSVRQAISLIGQLGKKGIVFNQDSYDSPI
FT                   VYSFTRLNEIKPEMIEEATHNAREVAEKFAKDSNSSLGKIRTASQGQFSIMDRDHNTPH
FT                   IKRIRVVSTVQYYLSD"
     atgagagaaa tgacaaccaa agccgcgttg attctaggtg tatccctaat tgtcggctta        60
     ggcgtattgg gttatctagt tcagcaaacg gccattcaat acaaagcact ggatcgcatt       120
     gtgacggtta aggggttatc ggagagagag tatcctgctg atacggtcat ttggccgatc       180
     cgttttacgg ttgccagcaa tgacatccaa gatcttttca ccaaagtgga tacgcaatca       240
     acgttaatca ccgattttct caataaacgt gaactttcag atagtgtcca atggtctgcc       300
     cctgcggtga ttgataagaa agctcagcaa tatgggggag aagcaaatgc ggaatatcgc       360
     tatctcgcca ttcaaaccat cacggtgtac agcaataaag ttgattcggt acgtcaagcc       420
     atcagtctta ttggacaact gggcaagaag gggattgttt tcaaccaaga ttcttacgac       480
     agcccgattg tctacagctt cactcgctta aacgaaatta agccggaaat gatcgaagaa       540
     gccactcaca atgcgagaga ggtggctgag aagtttgcca aagattccaa tagttcactt       600
     ggcaaaatcc gcacagcatc acaaggccag ttttctatca tggatagaga tcacaacacg       660
     ccacatatta aacgcattcg tgtggtttcg acggttcaat actatctttc tgattga          717
//

If you have problems or comments...

PBIL Back to PBIL home page