(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0513

BA000037.VV0513      Location/Qualifiers
FT   CDS_pept        complement(502236..502391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93277"
FT                   /db_xref="GOA:Q7MP51"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP51"
FT                   /protein_id="BAC93277.1"
FT                   /translation="MKEIPIKEQDKMMVIAGGLTRLRPDIANNRLLVSISSIGVFVLTE
FT                   LISLRF"
     ttgaaagaga tccctatcaa agagcaagat aagatgatgg tgatcgctgg tggactcact        60
     cgccttcgtc cagatatagc gaataaccgt ttgctggtat cgataagttc tatcggtgta       120
     tttgtcctta cagagctcat tagtctccga ttctaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page