(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0524

BA000037.VV0524      Location/Qualifiers
FT   CDS_pept        complement(508037..508480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93288"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93288"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP40"
FT                   /protein_id="BAC93288.1"
FT                   /translation="MVMIEQHYGELSIDDALHTSLEALLNRYTLPENAERLVLNCRQMS
FT                   YYRHRQGLHPIEVQFKRESASSTWLVVFFASFSYPDDNSTTVEPELYFHLANRWCYQPD
FT                   VGSTDLSHPEVQELLSVWMKAFARHLSRNVFDDVQLTMVGTFH"
     atggttatga ttgagcaaca ctacggtgag ctttctattg atgacgcttt acatacgtca        60
     ctggaagcac ttttgaatcg atacactctc ccagagaacg ctgaacgact tgtgttgaac       120
     tgccgccaaa tgagttacta ccgacatcga caaggtttac atccgataga ggtacagttt       180
     aaacgtgagt cagcttcaag cacgtggttg gtggtgttct ttgccagctt ctcttatccc       240
     gatgacaaca gcacaaccgt tgagcctgaa ttgtactttc accttgctaa tcgctggtgc       300
     tatcaacccg atgtaggaag cacggattta tcccatccag aggtacaaga gctgctctcg       360
     gtctggatga aagcctttgc tcgccacctt tccagaaacg tcttcgatga cgtgcaactg       420
     acgatggttg gtacgttcca ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page