(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0530

BA000037.VV0530      Location/Qualifiers
FT   CDS_pept        513467..514510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0530"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93294"
FT                   /db_xref="GOA:Q7MP34"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP34"
FT                   /protein_id="BAC93294.1"
FT                   /translation="MAFLFRRRFMYIIPLNKAQFNQQETILIQSEDFKVSAFKYNSGVE
FT                   GLKIENAKGYLTILPYMGQMIWDAKFLGEDICMENMFSEPKPSNEIVATYGCFAFHSGM
FT                   IRNGCPSPEDDHPLHGEMPCANMDKVWLEVDEYQITLKGEYEYVMGFGDHYLATPSVSI
FT                   EKGASMFEIKMKVQNLASVPMPLQYMCHMNTAYFPEAKMTQNIPDSAVKLRKSIPGHVK
FT                   PTQQWLDFNDTLKAQSAPIHQLSAPDMYDPEIVYFMDNLSQHTDNAEFEMTIPNGKTLI
FT                   TRFDTTEFNYATRWILYNGDQKVGAYVLPATCRPEGYLAAEKNGTLIQLQPKEVREFTV
FT                   KTGIIEK"
     gtggcttttc tgttccggag aagatttatg tatatcattc cactaaacaa agcacagttt        60
     aatcagcaag aaacaatttt aattcaatct gaggatttta aagtatcagc gttcaaatat       120
     aactctgggg tcgaagggtt aaaaatagaa aatgcgaaag gttatttaac aattctgcct       180
     tacatggggc aaatgatttg ggatgcgaaa tttctaggtg aagacatttg tatggagaac       240
     atgttttcgg agccgaaacc aagcaatgag attgtagcca catacggatg tttcgctttc       300
     cattctggca tgattagaaa tggttgtcca agtcctgaag atgaccaccc gctgcacggt       360
     gaaatgccgt gtgctaatat ggataaagta tggttagaag tcgatgaata tcaaattact       420
     ctaaagggtg aatatgagta tgtaatgggt tttggagacc actacttagc gactccgtca       480
     gtttctattg agaagggggc gtctatgttt gagattaaaa tgaaagtgca aaacttagct       540
     tcggtcccaa tgccactaca gtatatgtgt cacatgaata cggcatactt cccagaggcg       600
     aagatgacgc aaaacattcc ggatagtgcg gttaagttgc gtaaatcgat tcccggccat       660
     gttaagccaa cacaacaatg gctcgatttt aacgacacac tcaaagcgca atcagcaccc       720
     attcatcagc tttctgcacc agacatgtat gaccctgaaa tcgtttattt tatggataac       780
     ttgtctcagc atactgacaa tgctgagttt gaaatgacaa taccgaatgg caagacgtta       840
     attactcgat ttgatacgac agaattcaac tatgcgacgc gttggatctt gtacaacgga       900
     gaccaaaaag tcggagccta tgtcctgcct gcaacttgtc gaccagaagg ttacttagcc       960
     gctgagaaaa acggtacgtt gattcaattg caaccaaagg aagtgagaga gtttacagtg      1020
     aaaacaggca ttattgaaaa ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page