(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0535

BA000037.VV0535      Location/Qualifiers
FT   CDS_pept        complement(523603..524544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93299"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93299"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP29"
FT                   /protein_id="BAC93299.1"
FT                   /translation="MKNTTRLAALLSASATILCSPALARTWVEVGTEYEQYFDETDQGA
FT                   TYNYERLNAYTPYVRFSHSPTNNEWNIWGRAFKKYYTNEELFPNGEVNAQVDRLELHYT
FT                   QMNRKGAWRFRPGVGVRYNGYDIDRYETEYRLYPQFDYFFNSNSQAFLSGHWYIGDSKG
FT                   IRMGDTQPQNYTDWGYEAEFGWLYRFANGSSIKPHFYTEYDSYENNFDIDYWQFRLVYS
FT                   QKIGRATINPFIRYGLGRDITDRSHSDPERWGLKRDNNYSRAGVFGNVGISGKWNLIYE
FT                   TYYQVEDQHGTWGEELPDRDKFFAKFGIQRIF"
     atgaaaaaca cgactcgttt ggcggcattg ctgagtgcat cagccaccat actttgctca        60
     cccgcactcg ctcgaacttg ggttgaagtg ggtaccgaat atgaacaata cttcgatgaa       120
     accgatcagg gagcaacata taactatgag cgtttaaacg cctatacccc ttatgtgcgc       180
     ttctcgcatt ccccaaccaa caacgaatgg aatatttggg gcagagcatt taagaagtat       240
     tacaccaatg aagagctctt ccctaatggc gaagtgaacg ctcaagttga tcgcttagaa       300
     ttgcattaca ctcaaatgaa ccgcaagggt gcttggcgtt ttcgcccagg tgtcggcgtc       360
     cgatataacg gatatgacat agatagatac gagactgagt atcgtcttta ccctcaattc       420
     gactatttct tcaattcgaa cagccaagca tttttgagtg gacactggta tatcggagat       480
     tcaaaaggca ttcgcatggg tgatacccag ccacaaaact ataccgattg gggttatgaa       540
     gccgaatttg gttggctata tcgattcgcg aatggctcgt cgatcaagcc ccacttctat       600
     accgaatacg atagttacga aaacaacttt gatatcgact attggcaatt ccgcttggtt       660
     tatagccaaa aaatcggacg cgccactatc aatcccttta ttcgctatgg cttagggcga       720
     gatattaccg atcgttctca tagtgatcct gaacgttggg gactaaaaag agataacaac       780
     tactcacgtg caggcgtatt cggcaatgtg ggcatttctg gtaaatggaa ccttatttac       840
     gaaacctact accaagtcga agaccaacat ggcacttggg gtgaagagct gcctgaccgc       900
     gataagttct tcgctaaatt tggcatccaa cgcattttct aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page