(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0549

BA000037.VV0549      Location/Qualifiers
FT   CDS_pept        534852..535229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93313"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93313"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP15"
FT                   /protein_id="BAC93313.1"
FT                   /translation="MTDRNAPKYALFTQKTCYELLNQQLKRLNKLKSSLLLVLERPEIP
FT                   IHTNGSENDLREQVKRRKVSGGTRSDLGRQCRDTFSSLKKTYQKLDVSFWEYLNDRISQ
FT                   SNIIPTLGSLVLQKAHLASTY"
     atgactgatc ggaatgctcc gaaatacgca ctattcacac agaaaacctg ctatgagctc        60
     cttaatcagc aactaaaacg gttaaacaaa ttaaaatcga gcctattgtt ggtgttagaa       120
     cgaccagaaa ttccaattca tacgaatgga agtgaaaatg atctaaggga gcaggtcaag       180
     cgtcgcaaag tcagtggagg tactcgtagt gatcttggcc gacaatgccg agataccttt       240
     tctagcttga agaaaacgta ccaaaaatta gatgtttcct tctgggaata tctcaatgac       300
     cgaatttctc aaagtaacat aatccctacg ttaggctctc tagtactcca gaaagcccac       360
     cttgcctcga cttattga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page