(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0551

BA000037.VV0551      Location/Qualifiers
FT   CDS_pept        536143..536289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93315"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93315"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP13"
FT                   /protein_id="BAC93315.1"
FT                   /translation="MVGFVKCVDFLKRRFKNNYTPFHLIAILAAQSEMYAEDLSASDVV
FT                   MKE"
     atggttggtt ttgtgaagtg tgtagatttt ttaaaacgac gctttaaaaa taactataca        60
     ccttttcatc ttattgctat tttggcggca caaagtgaaa tgtatgctga agatctttca       120
     gcatctgatg tagttatgaa ggaataa                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page