(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0553

BA000037.VV0553      Location/Qualifiers
FT   CDS_pept        537086..537643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93317"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93317"
FT                   /db_xref="GOA:Q7MP11"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP11"
FT                   /protein_id="BAC93317.1"
FT                   /translation="MVDVFSQPLSIAQIVGLLSFALGLSTFYQKDDRRLKIVMLVFNFN
FT                   HLIHYLLMGSMMSVLSSLLSALRTATAVCLSTGRCTIKGAERIAVTVFISAGAVFGLTL
FT                   MDSVWELWPIVGTAIGTYALFMLKGIVMRLAFLVGASCWLINNILIGSIGGTLLELCVI
FT                   TINLVTIGRLLRDKKRLAVAGG"
     ttggtggacg tattctctca gccattgtcc attgcccaga tcgtagggct actgagcttc        60
     gcgttaggac tgtcgacctt ttaccaaaaa gatgatcgac ggttaaaaat cgttatgttg       120
     gtgttcaact ttaatcacct cattcactat ttgttaatgg gatcgatgat gtccgtgctg       180
     agttctttgt tatcagcatt gcgtactgcc acagcggttt gtctctcgac aggtcgttgc       240
     acgattaagg gtgctgagag gatcgcagtc actgttttta tatccgctgg tgctgttttt       300
     ggactgactc ttatggactc tgtctgggag ctttggccta tcgttggcac tgcgattggt       360
     acctacgcgc tgtttatgct caagggtatc gtgatgcgct tagcgttttt agtcggagcg       420
     agctgttggc taatcaataa cattttgatt ggctccatcg gcggtactct gcttgaactg       480
     tgcgtcatca caatcaattt agtcaccatt ggtcgcctgt taagagacaa aaaacgtctc       540
     gccgttgctg gtggatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page