(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0557

BA000037.VV0557      Location/Qualifiers
FT   CDS_pept        539992..540162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93321"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93321"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP07"
FT                   /protein_id="BAC93321.1"
FT                   /translation="MKLGRNDPCHCGSGKKFKRCCMSSVSKQHAQVFDDVETMLAMNPN
FT                   LGRDSNMEMLC"
     atgaagctcg gccgaaacga tccttgccat tgtggcagtg gtaaaaaatt taaacgttgt        60
     tgtatgagca gcgtttccaa gcaacatgcc caagtcttcg atgatgttga aaccatgctg       120
     gcaatgaacc caaatttggg tcgtgactcc aacatggaga tgttgtgtta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page