(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0572

BA000037.VV0572      Location/Qualifiers
FT   CDS_pept        553092..555248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0572"
FT                   /product="putative general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93336"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ3"
FT                   /protein_id="BAC93336.1"
FT                   /translation="MYKDFFGFSELPFSIVPNSRYLYLSQRHREAITHLQAGLGDGGGF
FT                   AMLTGEVGTGKTTVAKSMLANLDGQTCAALLLNPTFSSVELLEAICDEFGLSYAANASL
FT                   KQLNQRIYQFLLENHQQNIQTLLVIDEAQHLAADVLEQLRLLTNLETETRKLLKVLLVG
FT                   QPELQQLLQTTQLRQLAQRITGRYHLLPLNPQETADYIAFRIHTAGGNRTLFDHASAKV
FT                   IAQYSHGIPRLINLICDKALQLSYHQGDKKITKATVERACQNVMAFQAEIYQQTSNRSS
FT                   FPWGKVSVVAACVAGVLAIASYWPLIPTDNVVPTVPPVERDKPATELPILPSVPDILVN
FT                   DEQWLGESAVARMTTRAQGLEDLYKLWGYRATRIDTLCEQPSTSIFQCQVRQLNWQELQ
FT                   QTPHPLLLTLQHEGQRAYVVLLEVNSERVVLLTGEQRLTFTVPQLMSLWRGEVTDLWPM
FT                   PLRETLRLGMHGEAIAVLDQLLAKALNDEPLKTTQFNAELMQRVEWFQRWQAMTEDGIA
FT                   GQRTLARLQHMVSLSEPWRDFTKAEKQGEEQAMRYPEFPSLAPLPRTYPLAETGDAINV
FT                   ADQTSPTLVASPSIPSEEKKTADERLFENLDLSGLSPELAQKVENALLVETQTDHSPQT
FT                   ESTVSRLDLSAEKWHGRLPPLNLQTHMYSSDPKRRWLKINGAEFHQGEWIDNQIQLVEI
FT                   SAQSVIVEFQGEQIEIPALYEWKG"
     atgtataagg atttttttgg tttctctgag ctgcctttct cgatagtgcc caattcccgc        60
     tatctctatt taagtcagcg ccatcgtgaa gccatcacac atttacaggc tggcctcggc       120
     gatggtggtg gttttgccat gctgactggg gaagtgggga cggggaaaac cacagtcgca       180
     aaatcaatgt tggctaacct tgacggccaa acctgtgccg ctttgctgct caacccaacc       240
     ttttccagtg ttgaactgct tgaagccatt tgtgatgagt ttggcttgag ctacgcggcc       300
     aacgcttccc ttaaacagct caaccaacgc atttatcagt ttttgttgga aaatcatcag       360
     caaaatatcc aaaccttatt ggtgattgat gaagcacaac atttggcggc ggatgtattg       420
     gagcagttgc gtttattgac caatctggaa acggaaacac gcaagctgtt aaaagtgttg       480
     ttggtggggc aacctgaact gcaacaatta ctgcagacca cacaattgcg gcaacttgct       540
     cagcgcatta caggccgtta tcacctattg ccactgaatc ctcaagaaac cgcagactac       600
     attgcgtttc gtattcatac cgctggggga aatcgtaccc tgtttgatca cgccagcgcc       660
     aaagtgattg ctcagtatag tcatggtatt ccccgcctga ttaacttgat ttgcgataaa       720
     gcgttgcaat tgagctatca ccaaggcgac aaaaaaatca cgaaagcgac ggtcgagcga       780
     gcttgccaga acgtgatggc atttcaggct gagatctatc agcaaacctc aaaccgttcg       840
     tctttccctt ggggaaaagt gtctgtagtg gccgcttgcg ttgctggagt gttggctatt       900
     gccagctatt ggcctttgat ccccactgac aatgttgttc ccacagtgcc tccggttgag       960
     cgagacaagc cagcaaccga gttgccaata ctgccttcag tgccagacat cttggtgaat      1020
     gatgaacagt ggcttggtga gtcagctgtc gcgcggatga ccactcgagc gcaaggatta      1080
     gaagatcttt acaaattatg gggatatcga gcaacgcgca tcgatacctt gtgtgaacag      1140
     ccatccacgt cgattttcca gtgccaagtt cggcagctta attggcaaga gttgcagcaa      1200
     acgccacacc ctttgttgct gacactgcag catgaagggc aacgggctta cgttgtcttg      1260
     ctggaagtca actcagagcg cgtcgttctg cttacgggcg agcaacgtct cacattcacg      1320
     gttccacaat tgatgtcgtt atggcggggc gaagtcaccg atctatggcc aatgcctctg      1380
     agagagacat tgcgcctagg tatgcacggc gaggctattg cagttttgga ccaattgctc      1440
     gccaaagcac tcaatgatga accgttaaag acgacgcagt ttaatgctga gctgatgcag      1500
     cgagtggaat ggtttcaacg ttggcaagcg atgaccgagg atggcatcgc cggtcagcgt      1560
     actttggcgc gtttgcagca catggtctca ttgtccgagc cgtggcgaga cttcaccaag      1620
     gctgagaagc aaggcgaaga gcaggcgatg cgctatcctg agtttccctc gctcgcaccg      1680
     cttcccagaa catacccatt ggcggaaact ggcgacgcta tcaacgtggc cgatcaaaca      1740
     agccccactt tggtcgcgag cccatcaata ccgagtgaag aaaagaaaac agcggacgag      1800
     cgactgtttg aaaacctcga cctgtcaggc ttatcgccag aactggcgca aaaagtcgaa      1860
     aatgccttgc tggtggagac gcaaaccgac cactcaccgc aaacggagtc aacggtttca      1920
     aggctcgatc tgagcgcgga aaaatggcat gggcgcttgc cgccactcaa tttgcagaca      1980
     cacatgtatt cgagcgatcc gaaacgtcgc tggttgaaga ttaatggtgc ggagttccat      2040
     caaggtgagt ggatcgataa ccagattcaa ctggtggaga tttcagcgca gtcggtgatt      2100
     gttgagttcc aaggagagca gatcgaaatt ccagcgctct atgaatggaa aggctaa         2157
//

If you have problems or comments...

PBIL Back to PBIL home page