(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0574

BA000037.VV0574      Location/Qualifiers
FT   CDS_pept        complement(556117..557376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0574"
FT                   /product="pho4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93338"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93338"
FT                   /db_xref="GOA:Q7MNZ1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ1"
FT                   /protein_id="BAC93338.1"
FT                   /translation="MDILANYGTVLIIVAAVFGFMMAIGIGANDVANAMGTSVGSKALT
FT                   VKQAIIIAMIFEFAGAYLAGGEVTDTIRKGVIETSLFAHQPDVLVFGMMSALLAAGTWL
FT                   LLASYMGWPVSTTHSIIGAIIGFACVSVGTEAVDWSSVQGIVGSWIITPLISGFFAYVI
FT                   FVSAQRLIFDTEKPLMNAKRFVPVYMFITTMVIALVTIKKGLKHVGLHLSSTEAWFWSA
FT                   GVSGLVMLGGYLYIQKKFANREDDHGFAGVESIFSVLMVITACAMAFAHGSNDVANAIG
FT                   PLSAVVSTIEHMGEVTAKSTIAWWILPLGGFGIVVGLATMGHKVMATVGTGITELTPSR
FT                   GFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGIAALNLGVVRNIVASWVVT
FT                   LPAGALLAVVFYYAMQAIFG"
     atggatatcc ttgcgaacta cggcactgtc ctgattattg ttgcagctgt ttttggtttt        60
     atgatggcaa ttggtattgg cgcgaacgac gttgccaatg cgatgggcac atcggtaggc       120
     tcaaaagcac ttaccgtaaa acaagcgatc atcattgcga tgatcttcga atttgcgggt       180
     gcatatcttg caggcggtga agtaaccgac actatccgta aaggtgttat cgaaacatct       240
     ctctttgctc accaaccaga tgttcttgtc ttcgggatga tgtctgcgct cctagcagca       300
     ggtacatggc tactgttggc ttcttacatg ggttggccag tatcgaccac gcactctatt       360
     atcggtgcga tcatcggttt cgcctgcgtt tcagtcggca ctgaagcggt agactggagc       420
     agcgtacaag gcatcgtggg aagctggatc attacaccac tgatctctgg tttcttcgct       480
     tacgtcattt tcgtcagcgc acaacgcctg attttcgata cagaaaaacc attgatgaac       540
     gccaagcgtt tcgtacctgt gtacatgttt attaccacca tggtgattgc actggttacc       600
     atcaagaaag ggctaaaaca cgttggtctg cacctgagca gcaccgaagc gtggttctgg       660
     tctgccggtg tttctggcct tgttatgcta ggcggctacc tctacatcca gaagaaattc       720
     gctaaccgcg aagacgatca tggtttcgct ggcgtagaaa gcatcttcag cgttcttatg       780
     gtcatcaccg cttgtgcaat ggcattcgca cacggctcaa acgacgtagc aaacgcgatc       840
     ggtccactgt ctgccgttgt atcaaccatt gagcacatgg gcgaagtaac cgcgaaaagc       900
     actatcgctt ggtggattct tcctcttggt ggttttggta ttgttgtggg tcttgcgacc       960
     atgggccaca aagtaatggc aacggtgggt acaggtatca ctgaactgac tccaagccgt      1020
     ggttttgctg ctcagcttgc cactgcctca accgttgtac tggcttctgg tactggttta      1080
     ccaatttcga ccacacaaac acttgtgggt gcggtattgg gtgttggttt tgcacgcggt      1140
     atcgcagcac tcaacctagg cgtggttcgt aacatcgttg cctcttgggt tgtcaccctg      1200
     ccagcgggtg cactgcttgc cgtggtgttc tactacgcaa tgcaagcgat cttcggttaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page