(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0584

BA000037.VV0584      Location/Qualifiers
FT   CDS_pept        568170..568817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0584"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93348"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93348"
FT                   /db_xref="GOA:Q7MNY1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY1"
FT                   /protein_id="BAC93348.1"
FT                   /translation="MRCEMQQDDKQHAVFTPEDVEVLSKEPLFQGFFKMIKYRFRHKLF
FT                   AGGWSNVIEREMFERGHAAAMLPYDPIRDQVVLIEQIRVGALEHQHPWQLEIVAGMIDR
FT                   DESADDVVRREAQEEAGLEVGQLVSVVSYYPSAGGCSEKLDVFIGEVDASKAHGIHGLD
FT                   YEDEDIRVHVMTREQAYDLVKQGKIENGASIIALQWLELNHLQLKSQWLEIE"
     gtgaggtgcg aaatgcaaca ggatgacaaa caacacgctg ttttcactcc agaagatgta        60
     gaggttctct caaaagagcc actctttcag ggattcttca agatgatcaa gtaccgcttc       120
     cgtcataagt tatttgccgg tgggtggagc aatgtgatcg aacgcgaaat gtttgaacgt       180
     ggtcatgctg ctgcaatgct tccttacgat cctattcgtg atcaagtggt gttaattgaa       240
     caaattcgtg tcggagcact ggagcatcag catccttggc agttggaaat tgtcgcaggc       300
     atgatcgatc gtgatgaatc ggcggatgat gtcgtgcgtc gagaggcgca agaagaagct       360
     ggcctagaag tcggacaact tgtttcggtg gtttcgtatt atccttcagc gggtgggtgt       420
     tcagaaaagc tggatgtttt tatcggtgaa gtggatgcct ctaaagcgca tggcattcat       480
     ggtttagact atgaagatga agatatccgt gtgcatgtga tgacacgtga gcaagcctac       540
     gatttggtca aacaaggcaa aatcgagaat ggtgcctcaa ttatcgcctt acaatggtta       600
     gagttaaatc acttgcagtt aaagtcacag tggttggaga ttgagtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page