(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0585

BA000037.VV0585      Location/Qualifiers
FT   CDS_pept        568814..569266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93349"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY0"
FT                   /protein_id="BAC93349.1"
FT                   /translation="MMGLAAAKQPYYVDLAGLMRTYETNYAKLNALLPFNAEVGDVRCY
FT                   QVVNMIYQMTVKEVTKYTTIVEICQSDDIPLFPLPTMSVRLYHDARVAEVLSSGEHVRF
FT                   KAKYDYPNEKLMQKDEKHQLNAFLGEWLTFCLKSGISRTPITFKEE"
     gtgatgggtt tagcagcagc aaaacaacct tattatgttg atttggcagg gttaatgaga        60
     acctatgaaa ccaattatgc caaattaaat gctttgctgc cgttcaacgc tgaagtgggt       120
     gatgttcgct gttatcaagt tgtaaacatg atctaccaaa tgacagtgaa agaggtcaca       180
     aaatacacca ccatagtgga gatatgtcag agtgatgaca taccgttatt tcctttacct       240
     acgatgtctg tcaggcttta tcacgatgcc agagtcgcgg aagtgctctc gagtggtgag       300
     catgttcgat tcaaagcgaa atacgactac ccaaatgaaa agttgatgca gaaagatgaa       360
     aagcatcaat tgaatgcgtt tcttggcgag tggctgacgt tttgtttaaa aagcggtatt       420
     agccgaaccc caataacatt taaagaagaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page