(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0594

BA000037.VV0594      Location/Qualifiers
FT   CDS_pept        579870..580298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0594"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93358"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93358"
FT                   /db_xref="GOA:Q7MNX1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNX1"
FT                   /protein_id="BAC93358.1"
FT                   /translation="MKTFVAKPETVKRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYT
FT                   PHVDTGDYIIVINAEKVTVTGNKAAAKTYYRHTEFPGGIKSITFDKLIVRKPEMVIELA
FT                   VKGMLPRGPLGRAMYRKLKVYAGAEHNHVAQQPKVLDI"
     atgaaaactt tcgttgctaa accagaaact gtaaaacgcg actggtacgt tgtagacgct        60
     gaaggtaaaa ctcttggccg tctagcaagt gaaattgcat ctcgcctacg tggcaaacac       120
     aaagctgagt acactccaca cgttgacact ggtgattaca tcatcgttat caacgcggag       180
     aaagttactg taactggtaa caaagctgca gcaaaaactt actaccgtca cactgaattc       240
     cctggtggta ttaagtcaat cacttttgac aagctgattg ttcgtaaacc agaaatggtc       300
     attgagctag cggttaaagg tatgctacca cgtggtcctc taggccgtgc tatgtaccgt       360
     aagctaaaag tttacgctgg cgctgagcac aaccatgttg ctcaacaacc aaaagtacta       420
     gacatctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page