(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0595

BA000037.VV0595      Location/Qualifiers
FT   CDS_pept        580314..580706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0595"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93359"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93359"
FT                   /db_xref="GOA:Q7MNX0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNX0"
FT                   /protein_id="BAC93359.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGNIVINKRALEEYFGRPTSC
FT                   MVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGYV
FT                   TRDARCVERKKVGLRKARRRPQFSKR"
     atggcagaga atcaatacta cggcactggc cgtcgcaaaa gctcagctgc tcgtgttttc        60
     atcaaaccag gcagcggcaa catcgtaatc aacaagcgtg cgcttgaaga gtacttcggt       120
     cgtccaactt cttgcatggt tgttaaacaa cctcttgaat tggtagacat ggttgagaag       180
     ctagacctat acatcactgt taaaggtggt ggtatttctg gtcaagctgg cgcaatccgt       240
     cacggcatca ctcgtgctct tatggaatac gatgaatctc tacgtcctgc tctacgtgca       300
     gctggctacg ttactcgcga cgctcgttgc gttgaacgta agaaagttgg tctacgtaaa       360
     gcacgtcgtc gtccacaatt ctctaagcgt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page