(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0600

BA000037.VV0600      Location/Qualifiers
FT   CDS_pept        584363..584839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0600"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93364"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93364"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW5"
FT                   /protein_id="BAC93364.1"
FT                   /translation="MEIAQMTARRPYMLRAFYDWLVDNDLTPHLVVQATLAGVRVPQEF
FT                   IQDGQIILNIAPRAVGNLELGNDTISFNARFGGRPHSVIVPLYAVLAIYARENGAGTMF
FT                   EPEEAYTSIPGAEQEEDDGIWLEEEHSAPQPSIDFDDEPEPPRPKGRPSLRVVK"
     atggaaattg ctcaaatgac cgctcgccga ccgtacatgc taagagcatt ttacgattgg        60
     ctagtggata atgatttaac tcctcacctc gttgtgcaag caaccttggc tggagtgcgc       120
     gtacctcaag agtttattca agatggtcag attattctga acattgcccc gcgtgcggtt       180
     ggtaatcttg aattaggtaa cgacaccatc agctttaatg ctcgttttgg tggtcgtcca       240
     cattctgtga ttgttccgtt gtacgcggtg ctggcgattt atgctcgcga aaatggtgct       300
     ggcaccatgt tcgaacctga agaagcgtat accagtatcc ctggggctga gcaggaagag       360
     gacgatggta tttggttgga agaggagcat tcagcgcctc aacctagcat cgattttgat       420
     gatgaaccag agccaccgag acccaaaggt cgacctagct taagagtcgt taaataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page