(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0607

BA000037.VV0607      Location/Qualifiers
FT   CDS_pept        590888..591205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0607"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93371"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93371"
FT                   /db_xref="GOA:Q7MNV8"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV8"
FT                   /protein_id="BAC93371.1"
FT                   /translation="MRQAKPNLAKEIFFDLLTVGRTPLILLVLIFASAMAVVFATHHTR
FT                   QAITQKDEALQEREHLDNEWRNLMLEETALAEHSRVQEMAKKELEMKRPDGDKEVVINL
FT                   K"
     atgcgtcaag ccaagccaaa tctcgccaaa gaaattttct tcgacctact gacggtaggt        60
     cgaacgcctt tgatcttgct tgtcctgatc tttgcctcag cgatggcggt ggtttttgcc       120
     acccaccata cccgtcaagc gatcacccaa aaagatgaag cactgcaaga gcgtgagcat       180
     ttggataacg agtggcgcaa tctgatgttg gaagagaccg cactggctga gcacagtcgc       240
     gtgcaagaga tggcgaaaaa agagctcgaa atgaaacggc ctgatggcga caaagaagtg       300
     gtgattaatc tgaaatga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page