(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0608

BA000037.VV0608      Location/Qualifiers
FT   CDS_pept        591202..592932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0608"
FT                   /product="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93372"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93372"
FT                   /db_xref="GOA:Q7MNV7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV7"
FT                   /protein_id="BAC93372.1"
FT                   /translation="MMGKKSKTTVKPKESEQGTSLLIRWRFHLVLGFVFLAFAALVVRL
FT                   AFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGEPLAVSVPVEAVWADPVTIFKE
FT                   KALDNKQRWYALADVLGLQREELIERIERNENRRFIYLQRQVSPAMANYIRELKIPGVG
FT                   LKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWLTGEAGKQTIRKDRYGRVVE
FT                   NIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSGSAVMLDVKTGAVLAMVNA
FT                   PSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALENGVATKDTVIDTGNGILQ
FT                   VGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILGMYNSVGLGEPSGLNLV
FT                   GEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLAHAYATLGNEGMYEPIHIIKSNDRD
FT                   MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKTGTSRKATAGGYSDEYIT
FT                   YTAGVAPVSDPRIALVVVVNEPQGDDYYGGSVASPVFSEIMKGALQILNVAPDENAFQN
FT                   "
     atgatgggta aaaagagcaa aaccaccgtc aaacccaaag agagtgagca agggacatct        60
     ttgcttatcc gctggcgttt ccatttagtc ctaggatttg tattcctcgc gtttgccgcg       120
     cttgttgttc gtcttgcatt tattcaagtc attgagcctg acaaccttat tcgtgaaggg       180
     gatctgcgtt ctatccgtgt gaaagccctt ccgtccgcgc gaggtatcat ctccgatcgc       240
     aatggtgaac ctttagcggt gagtgttccc gttgaagctg tctgggccga tccggtgacg       300
     attttcaaag aaaaggcgct ggataacaaa cagcgttggt atgcgttagc cgatgtgtta       360
     gggctgcagc gtgaagaatt gattgaacgt atcgagcgca atgaaaaccg ccgcttcatc       420
     tacttgcagc gccaagtgag ccccgcgatg gcgaactaca tacgcgagct taaaattcca       480
     ggcgtggggc tgaaatcaga atcgcgccgc tattatcccg ctggtgaagt gagtgctcat       540
     ttagtgggcg taacgggtat cgatggtcac ggccttgaag gggtggaacg cagttacgat       600
     aactggttga ctggtgaagc gggtaaacag acgattcgta aagaccgtta tggccgcgtg       660
     gtggaaaaca ttgcctatga agacaggcaa gaaggcaagt cacttgaact caccattgat       720
     cagcgtctcc aagccattgc ttatcgcgcc atcaaacagg cggtggccga tcaccgtgcg       780
     acttctggtt cggcagtgat gttggatgta aaaaccggcg ccgtgttggc gatggtcaac       840
     gcgccttctt acaacccaaa caatcgcagt gattggcaaa gctacaagat gcgtaaccgc       900
     atcatcaccg attcgttgga gccaggctct acggtgaagc cttttgtgat tcttgccgcg       960
     ctggaaaacg gcgttgccac caaagacacg gtgatcgaca cgggcaacgg cattctccaa      1020
     gtcggtggca gtcgagttcg agatacgagt aaggtcggta aagcggatct gaccgaaatc      1080
     ctcaaaaaat ccagtaatat cggcgtgaca aaactgtcga tggaaatgcc cgtggaagcg      1140
     attctcggca tgtataactc ggttgggctt ggagagcctt ctgggttaaa tcttgttggc      1200
     gaagtgaccg gtattttccc tactcgttcg cgttggtctc cgattgagag agcgacgctg      1260
     tcgtttgggt acggtctgtc gatcactccg attcaattgg ctcatgccta cgcaaccttg      1320
     ggcaatgaag gtatgtacga gccgatccac atcatcaaaa gcaacgatcg tgatatggcg      1380
     aagcaagtgg tgtccaaaca acacgctcgt gaagtgctca atatgcttga aaccgtgacg      1440
     caaaaaggcg gctcagccag acgagcggcc gttccgggtt accgggttgg ggcgaaaacg      1500
     gggacatcac gtaaagcaac ggctggtggg tatagcgatg aatacatcac ctacacggcg      1560
     ggcgtggcgc cagttagcga tccgagaatt gctttggtcg tggtggtcaa tgaaccacaa      1620
     ggggatgatt actatggcgg ttccgtcgct tcccctgttt tttcagaaat tatgaaaggt      1680
     gcgctgcaaa ttttgaatgt ggcacccgat gaaaatgcat tccagaacta g               1731
//

If you have problems or comments...

PBIL Back to PBIL home page