(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0613

BA000037.VV0613      Location/Qualifiers
FT   CDS_pept        598283..599482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0613"
FT                   /product="bacterial cell division membrane protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93377"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93377"
FT                   /db_xref="GOA:Q7MNV2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV2"
FT                   /protein_id="BAC93377.1"
FT                   /translation="MVMVGNIKNNLFGWFRHSPPDALFDRQLVWIALCLMLTGLVMVTS
FT                   ASFPISSRLTDQPFHFMFRHATFLCLALGTSAVVLQIPLQKWQSHSHYLLGIAFALLVV
FT                   VLIAGKSVNGASRWIPLGLFNLQPAEVAKLALFIFMSGYLVRKQDEVRATFFGGFMKPI
FT                   MVFGALALLLLGQPDLGTVVVMLVTLFGMLFIAGAKLSQFLALMVAGITAVVGLILIEP
FT                   YRVRRVTSFLDPWEDPFGSGYQLTQSLMAFGRGEWFGQGLGNSIQKLEYLPEAHTDFVF
FT                   AVMAEELGFIGVVLILALIFSLVIKAVFIGKKAFEHQLQFGGYLAFGIGIWFAFQTLVN
FT                   VGAAAGMVPTKGLTLPLISYGGSSLIIMSIAVSILLRIDHECRLISMGNKTDLQTDEKE
FT                   "
     ttggtgatgg taggtaatat caaaaacaat ttgttcggct ggtttcgcca ctcaccacca        60
     gacgccttgt ttgatcggca gttggtttgg attgcattgt gtttaatgct gacggggctg       120
     gtgatggtga catcggcgtc ctttcctatc agctctcgtc tgacggatca gccttttcac       180
     tttatgttcc gccatgccac ttttttgtgc ttggcgttgg gcacctccgc agtagtgttg       240
     caaatcccac tacagaaatg gcaaagccat agccactatt tgttgggcat cgcatttgcg       300
     ttgctggtcg tggttttaat tgcgggtaaa tcggtgaatg gcgcgtcacg ctggatccct       360
     ctagggcttt ttaacctaca gccagcggaa gtggccaagc ttgcactgtt tatcttcatg       420
     tccggttatt tggttcgtaa acaggatgaa gtaagagcga ccttttttgg tggcttcatg       480
     aaacccatta tggtttttgg cgcgttagcg ctattgctac ttgggcaacc cgacttgggg       540
     acggtcgttg ttatgctggt caccttgttt ggcatgcttt ttatcgctgg agccaaattg       600
     agccagtttt tggcgttgat ggtcgctggg attaccgcgg ttgtaggatt gattctcatc       660
     gaaccgtatc gtgtaagacg tgtgacgtct ttcttagatc cttgggaaga cccatttggt       720
     agcggctatc agttgactca atcattaatg gcgtttggtc gcggtgaatg gtttggccaa       780
     ggtttgggta actcgattca aaaattagag tatttgccgg aagctcacac cgacttcgtg       840
     tttgccgtta tggcagaaga gcttggtttc attggtgtgg tgctgatctt agcactcatt       900
     tttagcctag tgatcaaagc ggtgtttatc ggtaaaaagg cgtttgaaca tcaattgcaa       960
     tttggtggat atctcgcttt tggtattggt atctggttcg cttttcaaac cctagttaat      1020
     gtaggggcag cagcggggat ggtccctacc aaaggtctta cgttaccgct gatcagctat      1080
     ggtggttcga gtttaattat tatgtccatc gctgtatcga ttcttctgag aattgatcat      1140
     gaatgccgac ttatctcgat gggcaataaa acagacttac agacagatga aaaagaataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page